KEGG   Ornithorhynchus anatinus (platypus): 100081484Help
Entry
100081484         CDS       T01045                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oaa01002]
    100081484 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oaa03110]
    100081484 (PCSK1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100081484 (PCSK1)
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S8: subtilisin family
   100081484 (PCSK1)
Chaperones and folding catalysts [BR:oaa03110]
 Intramolecular chaperones
  Subtilisin family
   100081484 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100081484
NCBI-ProteinID: XP_001512273
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MGPALVQGTVLELPDAEALRGLPASKFATLQADQRDLPAACSGSPIGSLENHYLFLHKNH
QRRSRRSAVHITKRLSDDDRVSWAEQQYEKQRSKRSVLRDSANNLFNDPMWTQQWYLQDT
RMTPTLPKLDLHVLPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPDASYDFNDNDHD
PFPRYDLTNENKHGTRCAGEIAMQANNKKCGVGVAFDSKVGGIRMLDGIVTDAIEASSIG
FNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRKGKGSIFVWASGNGGRQGD
NCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDYTDQRITSADLHNECT
VTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLALNPGWKKNGAGLMV
NSRFGFGLLNAKALVDLADRSTWRAVPEKKVCIVRDKTFEPRALRANGEVTIEIPTTACE
GQENVITSLEHVQLEATIEYSRRGDLHVTLTSASGTSTVLLAERERDTSPNGFKNWDFMS
VHTWGENPVGTWTLRITDMSGRIQNQGRIVNWRLILHGTSSQPEHMKNPRVYTSYNTVQN
DRRGVERMTDLAEDETTPDTLSETPPVSEGPNGYNSSRADKLTEQTPLDVIRRILQNALN
KQMVPNRAPKKTSKEELRILHRLFYQALERLNKLSPIRDSEDSLYGDDVDVFYNTKPYKH
RDDLLRQALLNILNGRN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgggacctgctttggtccaggggaccgtcctggagcttccggatgctgaggccctgcgg
gggctgccggcctcaaaatttgcaactctacaagccgaccaacgggacctgcccgctgcc
tgctctggctccccgattggatcacttgaaaatcactacttgttcctgcataaaaatcac
caaagaaggtctcggagaagtgccgttcatatcacaaagagattatcagatgatgatcgc
gtgtcttgggcggagcaacagtatgagaaacaacgaagcaaacgttctgtcctgagggat
tcagccaataacctcttcaatgatcccatgtggacccagcagtggtatctgcaagacacc
cggatgactccgaccctgccgaaactggatctgcacgtcctgcccgtctggcagaaagga
atcactgggaagggggtggtcatcaccgtgctcgacgacggcctggagtggaaccacacg
gacatctatgccaattatgatccagatgccagctatgattttaatgataacgaccacgat
ccgtttccgagatatgatctgacgaatgaaaacaaacatggcacaagatgtgctggcgag
atcgccatgcaagctaacaacaagaaatgtggggttggcgtcgccttcgattccaaagtt
ggaggaatacggatgctggatggcatcgtgacagatgctattgaagccagctcaatcggt
ttcaatccggaccacgtggacatctacagtgccagctggggacccaatgatgacggaaag
accgtggaaggtcccgggcggctggcccagaaagcttttgaatatgggatcaagcagggg
agaaagggaaaaggctccatcttcgtctgggcctctgggaacggcggccgccagggtgat
aactgcgactgcgatggttacacagatagtatctacactatctccatcagcagcgcctcc
caacaaggcctgtcgccctggtatgcagagaagtgttcttccacgttggccacagcgtac
agcagtggggattatactgaccagagaatcaccagcgccgacctacacaacgagtgcaca
gtgacccacacggggacatcagcctctgccccgctggccgctgggatcttcgctctcgct
ctagaggccaacccgaacctcacctggagggacatgcagcacctggtggtttggacttcc
gaatacgacccgctggccctgaaccccggctggaaaaagaatggagcggggctcatggtc
aacagccgctttggctttgggctcctgaatgccaaggccctggtggatctggccgaccgc
agcacctggcgtgccgtcccagagaagaaagtgtgtatcgtgcgagacaagacctttgaa
cccagagccctcagagccaatggagaagttaccattgaaattccgactacagcgtgtgaa
ggtcaggaaaatgtcatcacctccctggagcacgtgcagttagaagccacaattgaatac
tcccgcaggggagacctgcacgtcaccctcacctcagcctcaggaaccagtaccgtgctg
ttggctgaaagggagagggacacatcccccaacggctttaagaactgggatttcatgtca
gtccacacgtggggagagaacccagtgggcacttggacattacgaattaccgacatgtct
ggaagaatccagaaccagggccgaattgtaaactggaggctgattttgcatgggacgtca
tcccagcccgagcacatgaagaatcctcgcgtgtacacttcctacaatacggtgcagaat
gaccgcagaggggtggagaggatgactgatttggctgaggacgagaccacgccagacacc
ctgagcgagactcctccagtttcagaaggtcccaacgggtacaacagcagcagagccgat
aaactaactgagcaaactcctttagatgtcatacgccgaattctgcagaatgcactcaac
aaacagatggttccaaaccgagcaccaaagaagacttcgaaggaagagctacgcattcta
cacagactcttctatcaagccctggagagattaaacaaactttcccccatcagagactcc
gaggacagtctctacggtgatgacgttgatgtgttttacaacaccaaaccgtacaaacat
agagatgatctactgcggcaggccctcctcaacatcctcaatggacgaaactga

DBGET integrated database retrieval system