KEGG   Ornithorhynchus anatinus (platypus): 100081909
Entry
100081909         CDS       T01045                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04020  Calcium signaling pathway
oaa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100081909 (CACNA1E)
   04020 Calcium signaling pathway
    100081909 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100081909 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oaa04040]
    100081909 (CACNA1E)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100081909 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100081909
NCBI-ProteinID: XP_028937305
LinkDB
Position
16
AA seq 2463 aa
MVPEMLGLSPCPAPAPPEQIPTVATGGSLEPVASAATHRYALALPTEGMWRHHGPGLMTP
TLACSVLGLELPEDTRAPPASPRTVCFDVASILLPQEGEGPGWEGSGPMESGSGPFIPVS
PEVMKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGEGDPEQN
RNRQGTPVASAGTQAGFKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYA
KKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIK
IVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVS
GIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGF
DPPHPCGVQGCPAGYDCRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDAL
GATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNG
YRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPL
ARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLSVVALNTACVAIVHHNQPP
WLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRP
GTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGM
QLFGGRFNFSDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIY
FIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPN
MPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEAINKEEP
PPMNPLNPLNPLSPLNPLNAHPSLYRRPKASEGSGLEKCEEEEQGGQGEPPQAEEAPEDP
KSPTSRASGDLWPPRPCHGNCESEAGGGGGTGAGSEERARHRQSQRRSRHRRGRTEGKEP
PSTTEGRPASQDRGLHEGTPLREEGDGGVKDSQAEEEQEEVVASAQEEERSKELRRSTSL
TASEGPVLAGTMESGSVPLALELGAEAGVTGPEGGNLVPSEQALLGDLQLEMGRAISRSE
PDLSAVIANTEEAPKSTTVTVAIPDMDALVDSTVVHISNKTDGEASPLKEAEMKEDGEEM
EKKKRKKEKGSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIAL
AAEDPVLTNSERNKVLRYFDYVFTGVFTFEMIIKMIDQGLILQDGSYFRDLWNILDFVVV
VGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVF
NILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKR
HEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVF
PFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYR
VWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKII
AFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSSFNMSFLKLFRAARLIKLLRQG
YTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFF
GSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTASSGQNENERCGTDLAYVYFVSFIFFC
SFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTL
MSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQ
LDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQL
EEQKNAPMFQRMEPSSLPQEIITNAKALPYLQQDTLSGLSGRSGYPSLSPLSPQEIFQLA
CMDPNHGQFQEQQSLEPEVSEFKSVQSSNHGSYLPADTQERAASGRASSMPRLTVEPQVV
TDPSSMRRSFSTIRDKRTNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSSHRLNSDSGH
KSDPHRSGGRERGRSKERKHLLSPDVSRCNSEERGPQADGDSPERRQSRSPSEGRAQTPN
RQGTGSLSESSIPSISDTSTPKRSRRQLPPVPPKPRPLLSYASLLRHASSISPPPPDGSE
GGSPLPPQAPESNDACLTVSSSSPRGNRSRPSTPQRYISEPYLALHEDSHASDCGEEETL
TFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGAGPGMVCAAGGDLLSDTEED
DKC
NT seq 7392 nt   +upstreamnt  +downstreamnt
atggtgccagagatgcttggactcagcccgtgcccagcccctgcaccccccgagcagatc
ccgaccgtggccaccggtggaagccttgagccggtcgcctccgccgccacccaccgctat
gccctggccctgcccacggaggggatgtggcgccaccacggaccgggcctgatgacccct
accctggcctgctccgtgctggggctcgagctccctgaggataccagggccccgccggcc
tcccctcgtacggtctgctttgatgtggcctcgatccttctcccacaggagggtgagggc
ccaggctgggagggcagtggtcccatggagagcggatcgggccccttcatccctgtgagc
cccgaggtcatgaagcgccggcggggcggtctcattgagcagcgggacatcatcaaggcg
catgaggcccacaagatgcagagtactccccaggcccggcggaaggagtgggagatggcc
cgttttggggaagctgtggttggcaggccgggatccggagaaggagaccccgaacagaac
cggaaccggcaggggaccccggtggcctccgcggggacccaggcgggcttcaagcaatcc
aaggcccagagggcgcggaccatggcactgtacaaccccatcccggtcaggcagaactgt
ttcaccgtcaacagatccctctttatcttcggcgaggataacattgtcagaaaatacgcc
aagaaactcatcgactggccgccatttgagtacatgatcttggccacaattattgcgaac
tgcattgtcctggctctggaacagcatctcccagaggatgacaagactcccatgtcgcgg
aggctggagaagacggagccttatttcattgggatcttttgctttgaagctggaatcaaa
attgtggcccttggattcatcttccacaagggctcttatctccgcaacggctggaatgtc
atggactttatcgtggttctcagcggaattctggccacagccggaacccatttcaacacc
cacgtagacctgaggaccttgcgggctgtccgtgtgctgagacctctgaagctcgtgtcg
ggcattcccagtttgcagatcgtgttgaaatccatcatgaaggcaatggtgcccctcctc
cagattggtctcttgctcttcttcgccatcctgatgtttgccatcatcggcctggagttc
tacagtgggaagctacacagggcttgctttatgaacaattcaggcatacttgaaggattt
gacccgcctcatccatgtggggtgcagggctgccctgcgggctatgactgccgggactgg
attggtcccaatgacgggatcacccagtttgacaacattctctttgccgtgctgaccgtc
ttccagtgtatcaccatggaaggatggactaccgtgctgtacaacaccaacgatgccttg
ggagccacctggaactggctgtatttcatccctctcatcatcatcggctccttcttcgtc
ctcaacctcgtcctgggtgtgctttctggggagtttgccaaagagagagaaagagtggag
aaccgtcgcgccttcatgaagctgcggaggcagcagcagattgaacgggagctgaacggc
tatcgagcctggatcgacaaagccgaggaagtgatgctagccgaagaaaataaaaacgca
gggacatcggctttagaagtccttagaagggctaccatcaagaggagccggacagaagcc
atgactcgggactcaagcgatgaacactgtgtcgatatctcctctgtgggcacccctctg
gctcgtgctagcatcaagagtgccaaagtggatggggcctcctatttccggcacaaggag
cggctgctgcgcatttccattcgccacatggtcaagtcccaggtgttctactggatcgtt
ctgagcgttgtggctctcaacacagcctgtgtagccattgtccaccacaatcagcccccc
tggctcacccacctcctctactatgcagagttcttgtttttggggctcttcctcttggaa
atgtccctgaagatgtatggcatggggccacgcctctattttcattcttcattcaactgc
tttgattttggggtcacagtgggaagcatctttgaagtggtttgggcgattttcagacca
ggtacctcttttggaatcagcgtcttgcgggctctccgactcctgagaatatttaaagtg
acaaagtactgggcatccctgcgcaatttggtggtgtccctgatgagttccatgaagtcc
atcatcagcctgctcttcctcctcttcctcttcatcgtcgtttttgccctgttgggaatg
cagctctttggaggcaggttcaactttagtgatgggacaccttcagccaactttgacact
ttccccgcagccatcatgacggtattccagatcctgacaggggaggactggaacgaggtg
atgtacaacgggatacgctctcagggcggggtcagctcaggcatgtggtcagccatctac
ttcatcgtgctcaccttgtttggaaactacaccctgctgaatgtcttcttggccattgcc
gtggacaacctggccaatgcacaggagttgacgaaggatgagcaggaggaagaggaggcc
ttcaaccagaagcacgccctgcagaaggccaaggaggtcagcccgatgtccgctcccaac
atgcctgctatcgaaagagacaggaggaggagacaccacatgtcgatgtgggagccgcgc
agcagccacctgagggagcgcagaaggcggcaccacatgtcggtgtgggagcagcggacc
agccagctgcggcgtcacatgcagatgtccagccaggaggccatcaacaaggaggagccc
cctcccatgaaccccctcaacccgctcaaccctctcagccccctcaaccccctcaatgca
caccccagcctctaccggaggcccaaagctagtgagggctctgggctggagaagtgtgag
gaggaggagcagggaggtcagggggagccaccccaggccgaagaggccccggaagacccc
aagagccccacgtcacgggccagcggggacctgtggccgcccaggccttgccacgggaac
tgcgagtcggaggccggtggcggtggtgggaccggagcagggagtgaagagcgagcccgg
cacaggcagagtcagcgccgcagccggcatcgccgagggaggaccgagggcaaggaaccc
cccagcacgactgagggcaggcccgccagccaagacaggggactgcacgagggcacccca
ctccgtgaggagggggatgggggtgtgaaggacagccaggcagaggaggagcaagaggag
gtggtggcttcagctcaggaggaagagaggagcaaggagctgaggagaagcaccagtctg
acggcctccgaaggtcctgttttggctgggacaatggagagcggcagtgttcccctggcc
ctagagctgggggcagaggcgggggtgaccgggccggagggcggcaacctggtccccagt
gagcaggcgctgctgggagacctgcagctggagatgggccgggccatcagccgcagcgag
cccgacctctccgctgtcatcgccaatactgaggaggcccccaagagcaccactgtcacc
gtcgccatccctgacatggatgccttggtggactccacagtggtgcatattagcaacaag
acagatggagaagccagccccttgaaggaggcagagatgaaagaggatggcgaggagatg
gagaagaagaagcggaagaaggagaagggctcagaaacgggcaaagccatggtgcctcac
agctccatgtttatcttcagcacgaccaacccagtgcggagggcctgtcactacattgtc
aacctgcgctactttgagatgtgcatcctcctggtgatcgccgccagcagcatcgccctg
gccgccgaggatcccgtgctcaccaactctgagaggaacaaggtcctgaggtacttcgac
tatgttttcacgggcgtgttcacctttgagatgatcataaagatgatagaccagggcctg
atcctgcaggatggctcctacttccgagatctgtggaacatcctggactttgtcgtggta
gttggagcgttggtggccttcgccttggcgaacgctctggggaccaacaaaggtcgggac
atcaagaccattaagtccctgcgggtgctccgtgtcctgagacccctgaaaactatcaag
cggctccccaaactcaaggctgtctttgactgtgtagtgacctccctgaagaatgtcttc
aacatactcatcgtctataagctcttcatgttcatctttgctgtcatcgctgtccagcta
tttaaagggaagttcttttattgcacggacagctccaaggacacggaaaaggaatgcata
ggcaactacgtagaccacgagaaaaataagatggaggtgaagggtcgggaatggaagcgt
cacgaatttcattacgacaacatcatctgggccttgctgaccctcttcaccgtctccacg
ggcgagggctggccacaggtgcttcagcattccgtggatgtgactgaagaggatcggggc
ccaagccgtagcaaccgcatggagatgtccatcttctacgtggtctactttgtggtcttc
cccttcttctttgtcaacatcttcgtggctctgatcatcatcaccttccaagagcaaggg
gacaagatgatggaagagtgcagtctggagaaaaatgagcgggcctgcatcgactttgcc
atcagcgccaaaccgcttacccgctacatgccgcagaaccgccataccttccagtaccgc
gtctggcacttcgtggtatccccatcctttgaatacaccattatggccatgattgccctg
aacacagtggtcctgatgatgaagtattattcagccccttgcacgtatgagttggccctg
aagtatctcaacatcgccttcactatggtgttctccctggaatgtgtcctaaagatcatc
gcctttggattcttgaactatttccgggacacgtggaacatctttgacttcatcacggtg
attggcagcatcacagagatcatcctgactgacagcaagctggtgaacaccagcagcttc
aacatgagctttctgaagctgttccgagccgctcgcctcatcaaactcctccgtcagggc
tacaccatccgcattttgctgtggaccttcgtgcagtccttcaaggccctcccttatgtc
tgcctcctgatcgctatgctgttcttcatttacgccatcattgggatgcaggtttttggg
aacatcaaattagatgaagaaagtcacatcaatcgccacaacaacttccgcagttttttt
gggtctctcatgctgctcttcaggagtgccacgggtgaggcgtggcaggagattatgctc
tcctgcttgggagagaaaggctgtgaaccggacactaccgcctcctcggggcaaaacgag
aatgagcgctgtggcactgacctggcctacgtgtacttcgtttccttcatcttcttctgc
tccttcctgatgctcaacctatttgtggctgtgatcatggacaactttgagtacctgact
cgggactcctccatcctggggccacaccacctggacgagtttgtccgaatctgggcagag
tacgaccgggctgcatgtggccgcatccattacactgagatgtatgaaatgctgactctc
atgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcgtataagaggctg
gttctgatgaacatgccggtggcagaggatatgactgtccacttcacctccacactaatg
gccctgattcggacggcgctggacatcaaaattgcaaaaggtggtgcggacaggcagcag
ctcgattcagagctgcaaaaggagactctagccatttggcctcacctgtcccagaagatg
ctggacctgctggttccaatgccaaaagcctcagacctaactgttggcaaaatatatgca
gccatgatgatcatggactactacaagcagagcaaagtgaagaagcagagacagcagttg
gaggagcagaaaaatgcccccatgttccagcgcatggagccctcatctctgcctcaggag
attattactaatgccaaagccctgccttacctccaacaagacaccctttcgggcctgagt
ggccggagtgggtatccatccctgagtccactctccccgcaggaaatattccagttggcg
tgcatggacccaaaccatggccagttccaggagcagcaatctctggagccagaggttagt
gagtttaaaagcgtgcagtcctctaaccatggcagctacctccctgcggacacccaggag
cgggcagcctcggggagggcatcttcgatgccgcgcctgaccgtggagccccaggtggtg
acagacccgagctccatgagacggtccttctccaccatccgggacaagcgcaccaacagc
tcctggttggaggagttttccatggagcggagcagtgaaaacacatacaagtctcgccgg
cgtagctaccactcatcgctgcgcctgtcgtctcaccgcctcaactccgactccggccac
aaatcggacccccaccgctcgggtggccgcgagagagggcgatccaaagagcgcaagcac
cttctctctcccgatgtctcccgctgcaattcggaggagcgaggcccccaggccgacggc
gattccccggagcggcgccagtcccgctcacccagcgagggtagagcccagacacccaac
aggcagggcacgggctccctgagtgaaagctccatcccttccatctctgacaccagcacc
ccgaaacgaagccgacggcagctcccgccggtcccacccaagccccggcccctcctctcc
tacgcctccctgctccgacacgccagcagcatctcccccccaccccccgacgggagcgaa
ggtggctccccgttgcccccgcaagctccggagagcaacgacgcctgcctgaccgtgtct
tccagctccccccgagggaaccggagccgcccttccaccccgcagcgctacatctcggag
ccctacctggccctgcacgaagactcccacgcctcagactgtggcgaggaggagacgctc
accttcgaggcggccgtggccaccagcctgggccgctccaacaccattggctcggcccct
cccctgaggcacagctggcagatgcccaatgggcactaccggcggaggcggcgggggggc
gcggggccggggatggtgtgcgcagctggaggcgatctcctgagtgacacggaagaggac
gataaatgctag

DBGET integrated database retrieval system