KEGG   Ornithorhynchus anatinus (platypus): 100082618
Entry
100082618         CDS       T01045                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04020  Calcium signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04024  cAMP signaling pathway
oaa04260  Cardiac muscle contraction
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04270  Vascular smooth muscle contraction
oaa04713  Circadian entrainment
oaa04720  Long-term potentiation
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04727  GABAergic synapse
oaa04728  Dopaminergic synapse
oaa04742  Taste transduction
oaa04911  Insulin secretion
oaa04912  GnRH signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04924  Renin secretion
oaa04925  Aldosterone synthesis and secretion
oaa04927  Cortisol synthesis and secretion
oaa04929  GnRH secretion
oaa04930  Type II diabetes mellitus
oaa04934  Cushing syndrome
oaa04935  Growth hormone synthesis, secretion and action
oaa05010  Alzheimer disease
oaa05020  Prion disease
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05031  Amphetamine addiction
oaa05410  Hypertrophic cardiomyopathy
oaa05412  Arrhythmogenic right ventricular cardiomyopathy
oaa05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100082618 (CACNA1C)
   04020 Calcium signaling pathway
    100082618 (CACNA1C)
   04024 cAMP signaling pathway
    100082618 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100082618 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100082618 (CACNA1C)
   04929 GnRH secretion
    100082618 (CACNA1C)
   04912 GnRH signaling pathway
    100082618 (CACNA1C)
   04921 Oxytocin signaling pathway
    100082618 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100082618 (CACNA1C)
   04924 Renin secretion
    100082618 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100082618 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100082618 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100082618 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100082618 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100082618 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100082618 (CACNA1C)
   04727 GABAergic synapse
    100082618 (CACNA1C)
   04725 Cholinergic synapse
    100082618 (CACNA1C)
   04728 Dopaminergic synapse
    100082618 (CACNA1C)
   04726 Serotonergic synapse
    100082618 (CACNA1C)
   04720 Long-term potentiation
    100082618 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100082618 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100082618 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100082618 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100082618 (CACNA1C)
   05020 Prion disease
    100082618 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100082618 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100082618 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100082618 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100082618 (CACNA1C)
   05414 Dilated cardiomyopathy
    100082618 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100082618 (CACNA1C)
   04934 Cushing syndrome
    100082618 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oaa04040]
    100082618 (CACNA1C)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100082618 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100082618
NCBI-ProteinID: XP_028910254
LinkDB
Position
X4
AA seq 2222 aa
MHIPQENHQGSAHGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGS
AGHATISTVSSTQRKRQQYGKQKKQGSAATTRHPRALLCLTLKNPVRRACISVVEWKPFE
IIILLTIFANCVALAIYIPFPEDDSNVTNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHP
NAYLRNGWNLLDFIIVVVGLFSAILEQGTKTDGSNALGGKGAGFDVKALRAFRVLRPLRL
VSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNIQEGLTD
APVEDDPSPCALSSGHGRQCANGTVCRAGWDGPKHGITNFDNFAFAMLTVFQCITMEGWT
DVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLRE
KQQLEEDLKGYLDWITQAEDIDPDNEDEGMEEEKPRNMSMPTSETESVNTENVAGGDIEG
QSCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHY
NQPDWLTEVQDTANKVLLSLFTAEMLLKTYSLGLQAYFVSLFNRFDCFIVCGGILETILV
ETQIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFS
LLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPG
MLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEK
KQEAEKPAVEEDTKEEKIELKSITADGDSVPATKINMENLQPNENEENTPYANPEATGEE
EEEEEEPEMPVGPRPRPLSELHLKEKAVPMPDASAFFIFGPSNRFRRQCHRIVNDTIFTN
LILFFILLSSVSLAAEDPVRNSSFRNQILFYFDIVFTAIFTIEIALKILGNADYVFTSIF
TLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLR
PLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQ
TEAECKGNYITYKDGEVAHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRS
IDSHTEDVGPTYNHRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDK
NQRQCVEYALKARPLRRYIPKNRHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS
CLFKQAMNILNMVFTGLFTVEMILKLIAFKPKDYFSDPWNVFDFLIVIGSIIDVILSETN
HYFCDAWNTFDALIVLGSIVDIAISEVNPAEHTQCSSSSVNAEENSRISITFFRLFRVMR
LVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINR
NNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKKCAPDSDVQNATAAPSADPTALTEAE
PPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEY
DPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFA
LVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLI
QEYFRKFKKRKEQGLVGKPSQRNTLSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMK
EAVSAASEDDIFRRAGGLFGNHVSYYQSDGRACFPQHLATQRPLHINKAASGQGEPGSPS
HEKLVDPTFTPSSYSSSGSNANINNANNTALGRFPGPTGFPSYASTVCVVEGPDLPPSPA
PRGLEAPWKRSAKRGSSRRLGVAAQPEERGPGEAGQDHLDPDVAYCNVLSSRDEEGRQRT
PPPPPPPPPPDPRPARPSPKRGFLRSASLGRRASFHVDCLRRPREQGAEAGADAPQKSAL
PLHLLRHQALAVAGLSPLPQRSHPPAAFPRPCATPPATPCGRPWPPQPVPTLRLDGVASS
DKLNSSCPSVHRGSRSPRRARPVSLTVPGPVPGPGAGPFHGSASSLVEAVLISEGLAQFA
HDPKFIEVTTQELADACDLTIEEMESAADRILSGREGAGGGQSPQDGLLLLVDCRAPGPD
SAGEDQEEEDDDEEDQPEEEARDGGEEASASPGRAEGPRGSREREEEDGEGLQDSRVCIG
GP
NT seq 6669 nt   +upstreamnt  +downstreamnt
atgcacattccccaggagaatcaccaaggctctgcccacgggagcccccgcccggctcac
gccaacatgaacgccaacgcggccgcgggcctggcgcccgagcacatcccgacgcccggg
gcggccctgtcctggcaggcggccatcgacgcggcccggcaggccaagctgatgggcagc
gccgggcacgccaccatctccaccgtcagctccacccagcggaagcgccaacagtacggg
aagcagaagaagcaggggagcgcggccacgacccgccacccccgggcgctgctctgcctc
accctcaagaaccccgtccgcagggcctgcatcagcgtcgtcgagtggaaacccttcgaa
atcattattttactgaccatctttgccaactgcgtggccttagccatctacatccccttt
ccagaagacgattcgaacgtcaccaactccaacctggaacgagtggaatacctcttcctc
atcattttcacagtggaagcgtttttaaaagtcatagcctatggactcctcttccaccct
aatgcttacctccggaacggctggaatttacttgattttatcatcgtggtggtcggcctc
ttcagcgccatcctagaacaagggaccaagacagacgggtccaacgctctgggcgggaaa
ggcgccggcttcgacgtcaaggctctgagggccttccgggtcctgcggcccctgcggctg
gtgtccggagtccccagcctccaggtggtcttgaattccatcatcaaggccatggtcccc
ctgctgcacatcgccctgctggtgctgttcgtcatcatcatctacgccatcatcggtctg
gagctgttcatggggaagatgcacaagacgtgctacaacatccaggagggtctgacagac
gcccccgtggaagacgacccatcgccctgcgccctgagcagcgggcacggccgccagtgc
gccaacggcaccgtgtgccgggccggctgggacgggcccaagcacggcatcaccaacttc
gacaacttcgccttcgccatgctgaccgtcttccagtgcatcaccatggaaggctggacc
gatgtcctctactgggtgaatgacgcagtaggacgggactggccgtggatatattttgtt
acgctaatcatcatagggtcattttttgttctaaatttggttctcggtgtccttagcgga
gagttctccaaagagagggagaaggcaaaagcacgaggagacttccagaagttgcgagag
aagcagcagctggaggaggacctgaaggggtacctggactggatcacccaagcggaggac
atcgacccagacaacgaggatgaaggcatggaggaggagaaacccagaaatatgagcatg
cccaccagcgagacggagtccgtcaacaccgagaacgtggccggcggcgacatcgagggc
cagagctgcggggcgaggctggcgcatcggatctccaagtccaagttcagccgctactgg
cgtcggtggaatcgcttctgccggcgcaagtgccgggcggcggtcaagtccaacgtgttc
tactggctggtcatcttcttggtcttcctgaacactctcaccatcgcctccgagcactac
aaccagcccgactggctcaccgaggtccaagacacggcgaacaaggtgctgctgtcgctc
ttcacggccgagatgctgttgaagacgtacagcctggggctgcaggcctacttcgtctcc
ctcttcaaccgcttcgactgcttcatcgtgtgcggtggcatcctggagaccatcctggtg
gagacccagatcatgtcccccctgggcatctccgtcctcagatgcgtccgcctcctgcgc
atatttaagatcacgaggtactggaattccttgagcaacctggtggcgtcgttgctgaac
tcggtgcgctccatcgcctcgctgctgctcctgctcttcctcttcatcatcatcttctcc
ctcctgggcatgcagctcttcggcggcaagttcaacttcgacgagatgcagacgcggcga
agcaccttcgacaacttcccccagagcctcctcaccgtctttcagatcctgacgggggag
gactggaattcggtgatgtatgatggaatcatggcttatggcggcccctcttttccaggg
atgttggtctgtatctacttcatcatcctcttcatctgtggaaactatatcctgctgaat
gtattcttggccatagcagtggacaatctggctgatgccgagagcctcacgtctgctcag
aaggaggaagaggaggagaaagagaggaaaaagctagctaggaccgccagccccgagaag
aagcaggaggcggagaagccggccgtggaggaggacaccaaggaggagaagatcgagctg
aagtccatcaccgctgatggagattcggtgcccgccaccaagatcaacatggagaacctg
cagcccaatgagaatgaggagaacaccccctacgccaacccggaggctacaggggaggag
gaagaggaggaggaggagcccgagatgccggttggcccccgccctcgcccgctgtcggaa
ctgcacctcaaggagaaggccgtgcccatgccggatgccagcgccttcttcatctttggc
cccagcaacaggttccgtcgccaatgtcaccgcatcgtcaacgacaccatcttcaccaat
ctgatcctcttcttcatcctgctgagcagcgtctccctggccgcggaggatcccgtccgc
aactcctccttccggaatcagattttattttattttgatatagtttttactgccattttc
accattgaaattgctctgaagatcctaggcaatgcagactatgtcttcactagtatcttt
acattagaaattattcttaagatgacggcctacggggccttccttcacaagggctccttc
tgccggaactacttcaacatcctggacctgctcgtcgtcagcgtgtccctcatctccttc
gggatccagtccagcgccattaacgtggtgaagatcttgcgggtcttgcgtgtgctccgc
cccctgagggccatcaacagagccaaaggcctgaagcacgtggtgcagtgcgtattcgtg
gccatccgcaccatcgggaacatcgtcatcgtcaccaccctgctgcagttcatgttcgcc
tgcatcggcgtccagctgttcaagggcaagctgtacagctgcaccgacagctccaagcaa
acagaggcagaatgcaagggaaactacatcacgtacaaggacggcgaggttgcccaccct
atcatccagccccgcagctgggagaacagcaagttcgacttcgacaacgtcctggccgcc
atgatggccctcttcaccgtgtccaccttcgagggctggcccgaactcctgtaccgctcc
atcgactcccacaccgaggacgtgggccccacatacaatcaccgggtggagatctccgtc
ttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtcggtttc
gtcatcgtcaccttccaggagcagggcgagcaggagtacaagaactgtgaactagacaaa
aaccagcgccagtgtgtggagtacgccctgaaggcccgccccctccgccgttacatcccc
aagaaccggcaccagtacaaggtctggtacgtcgttaactccacctacttcgagtacctc
atgttcgtgctcatcctgctcaacaccatctgcttggccatgcagcactatggtcagagc
tgtctcttcaagcaagccatgaacatcctcaacatggtcttcaccggactcttcaccgtc
gagatgatcctgaagctgatcgccttcaaacccaaggattactttagtgatccttggaat
gtttttgacttcctgatcgtaattggcagcataattgacgtcattctcagtgaaactaat
cactatttctgtgatgcatggaacacatttgacgccttgattgttctgggtagcattgtt
gatatagctatcagcgaggtgaacccagctgaacatacccagtgctcctcttcctctgtg
aacgcagaggaaaattcccgcatctccatcactttcttccgcctgttccgggtcatgcgc
ctagtcaagctcctgagccgcggggaggggatccggacgctgctatggaccttcatcaag
tctttccaggccctcccttacgtggctcttctgatcgtgatgctgtttttcatctacgcc
gtgatcggcatgcaggtgtttggaaaaatcgccctgaacgacaccaccgagatcaacaga
aacaacaacttccagaccttcccgcaagcagtgctgctgctcttcaggtgcgccacgggc
gaggcctggcaggagatcatgctggcctgtatgccgggcaagaagtgcgccccggactcg
gacgtgcagaacgccaccgcggccccctccgctgaccccaccgccctcaccgaggccgag
cccccctgcgggagcagcttcgccgtgttctatttcatcagtttctacatgctctgtgcc
ttcctgatcatcaacctgttcgtggccgtcatcatggacaacttcgactacctgaccagg
gactggtctatcctgggcccgcatcacctggacgagttcaagcggatctgggccgagtac
gatccggaggccaagggacggatcaagcacctggacgtggtgacgctgctccgaaggatc
caacctcctctggggtttgggaagctctgccctcaccgggtagcttgcaaacgtctggtg
tccatgaatatgcccctgaacagcgacgggacggtcatgtttaacgccaccctgttcgcc
ctggtccgcaccgcgctgaggatcaagaccgaaggaaacctggaacaagccaacgaggag
ctccgggccatcatcaagaaaatctggaagcgcacgagcatgaaactgctcgaccaagtc
gtgccccccgcgggcgacgacgaggtgacggtggggaagttctacgccacgttcctgatc
caggagtatttccggaagttcaagaagcgcaaggagcagggattggtgggaaaaccctcc
cagaggaacactctctccttgcaggccggactgcgcaccctacacgacatcgggccggag
atccgccgggccatctccggggacctcacggccgaggaggagctggacaaggccatgaag
gaagccgtctccgccgcctccgaggacgacatcttcaggagagccggtggcctctttgga
aaccacgtcagctactaccaaagcgacggcagggcctgcttcccccaacacctggccacc
cagcggcccctacacatcaacaaggcggcgagcggccaaggcgaaccggggtctccctcc
cacgagaagctggtggaccccaccttcacgcccagcagctactcctcgtcgggctccaac
gccaacatcaacaacgccaacaacacggccctgggccgcttccccggtcccaccggcttc
cccagctacgccagcaccgtgtgcgtggtggagggcccggacctgccgccgtcgcccgcc
ccccgagggctcgaggctccgtggaagcgcagtgccaagaggggcagctcgcggcggctg
ggggtggcggcccagcccgaggagcggggtccgggcgaggccggccaggaccacctggac
ccagacgtggcctactgcaacgtgctgtcctcccgggatgaagaaggccgccagcggacc
ccgccgcccccgcccccgcccccgccgccggacccgcgccccgcccgaccctccccaaag
cggggcttcctccgctccgcctcgctcggccggagagcctccttccacgtggactgcctg
agacggccgagggagcaaggagccgaagccggagcggacgccccccagaagtcagcgctg
cccctgcacctgctgcggcaccaggctttggcggtggccggcttgagccccctcccgcag
agaagccatcccccggccgccttccctcggccttgcgcgacgccccccgcgacgccctgc
ggtcgcccctggcccccgcagcccgtgcccaccctgcggctggacggggtggcgtccagc
gacaagctgaacagcagctgcccctcggtgcaccgcggctccaggagcccacggagggcc
aggcctgtgtccctgacggtgcccgggccggtgcccgggccgggggccgggcccttccac
gggagtgccagcagcctggtggaagcggtgttgatttcggaaggactggctcagttcgcc
cacgaccccaagttcatcgaggtcaccacccaggagctggccgacgcctgcgacctgacg
atagaggagatggagagcgcggccgaccgcatcctcagcggccgagaaggggcaggggga
ggccagagcccccaggacggcctcctcctcctggtggactgcagggcccccggcccggac
agcgcgggggaggaccaggaggaagaggacgacgacgaggaggaccagccggaggaggag
gcccgggatgggggagaggaggcctcggcctcccccggcagggccgagggtccgcggggc
tcccgggagcgggaggaagaagacggggagggtcttcaggacagcagggtctgcatcggc
ggcccgtag

DBGET integrated database retrieval system