Ornithorhynchus anatinus (platypus): 100082925 Help Entry 100082925         CDS       T01045                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04060   Cytokine-cytokine receptor interaction oaa04151   PI3K-Akt signaling pathway oaa04217   Necroptosis oaa04380   Osteoclast differentiation oaa04620   Toll-like receptor signaling pathway oaa04621   NOD-like receptor signaling pathway oaa04622   RIG-I-like receptor signaling pathway oaa04623   Cytosolic DNA-sensing pathway oaa04630   JAK-STAT signaling pathway oaa04650   Natural killer cell mediated cytotoxicity oaa04668   TNF signaling pathway oaa04936   Alcoholic liver disease oaa05135   Yersinia infection oaa05142   Chagas disease oaa05152   Tuberculosis oaa05160   Hepatitis C oaa05161   Hepatitis B oaa05162   Measles oaa05163   Human cytomegalovirus infection oaa05164   Influenza A oaa05165   Human papillomavirus infection oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05168   Herpes simplex virus 1 infection oaa05169   Epstein-Barr virus infection oaa05170   Human immunodeficiency virus 1 infection oaa05171   Coronavirus disease - COVID-19 oaa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100082925 (IFNB1)    04668 TNF signaling pathway     100082925 (IFNB1)    04151 PI3K-Akt signaling pathway     100082925 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100082925 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100082925 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100082925 (IFNB1)    04621 NOD-like receptor signaling pathway     100082925 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100082925 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100082925 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100082925 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100082925 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100082925 (IFNB1)    05161 Hepatitis B     100082925 (IFNB1)    05160 Hepatitis C     100082925 (IFNB1)    05171 Coronavirus disease - COVID-19     100082925 (IFNB1)    05164 Influenza A     100082925 (IFNB1)    05162 Measles     100082925 (IFNB1)    05168 Herpes simplex virus 1 infection     100082925 (IFNB1)    05163 Human cytomegalovirus infection     100082925 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100082925 (IFNB1)    05169 Epstein-Barr virus infection     100082925 (IFNB1)    05165 Human papillomavirus infection     100082925 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100082925 (IFNB1)    05152 Tuberculosis     100082925 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100082925 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100082925 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100082925 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     100082925 (IFNB1) Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Interferons    100082925 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100082925 NCBI-ProteinID:  NP_001229650 Ensembl:  ENSOANG00000045969 UniProt:  A8E6E1 LinkDB All DBs Position X2:complement(18178220..18178858) Genome browser AA seq 212 aa AA seqDB search MEARELQTLHLININLSNPEQHPNTMTNRSSLPFVLWLLLPTTIMAQGYPKLYSHQWLSN WQSLHLLDEMGGQFPLHCLKEKTNFKLPAEMMHPHQFQQENATEAIHDLLQNIFNIFGRN HSQTGWDEATVEKFLHGVHKEMMRLELFLEEEMGWENSTLRGDVSLHIKSYFKGMMDYLK GRDYSSCAWEVTRMEAKRCFLVMYRLTRKLKK NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atggaagcccgagagcttcagacactccatctcatcaacatcaacctcagcaaccctgaa caacacccgaacaccatgaccaacaggagttcgttaccatttgttctgtggctgctcctc cctacgaccatcatggctcaaggctaccccaagctgtattcccaccaatggctgagcaac tggcagagcctgcaccttctggatgaaatgggtggacagtttcctctgcactgcctcaag gagaagacgaacttcaagctgcccgcagagatgatgcatccacaccagttccagcaggaa aatgccactgaggccattcatgacctgctccagaacatcttcaacatcttcggcagaaat cactcccaaactggctgggatgaagccactgttgagaaattcctccatggagtccataag gagatgatgcggctggagctgtttctggaagaggaaatggggtgggaaaacagcaccttg agaggggacgtcagcctgcacattaagagctacttcaaggggatgatggattatctgaag ggcagagactacagcagctgcgcctgggaggtgacccgaatggaagccaagagatgcttt ctagtcatgtacagactcacaagaaagctcaagaaataa

DBGET integrated database retrieval system