KEGG   Ornithorhynchus anatinus (platypus): 100083052Help
Entry
100083052         CDS       T01045                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00052  Galactose metabolism
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
oaa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100083052
   00500 Starch and sucrose metabolism
    100083052
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100083052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100083052
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100083052
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100083052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 100083052
NCBI-ProteinID: XP_007655452
LinkDB All DBs
Position
2
AA seq 1067 aa AA seqDB search
MKAYHKLPFRETQITAGPFGEEEEEEEDEEEEEPPKPVGPPKLGPLLWWLGSALLAGAVL
LGGAAFWALGRQEVAAPPPKCSSVPEAHRFDCYPERDTVVTEELCRGRGCCFLQDGGSAG
PPWCFYPPDFPSYTLESVRQTAVGLEGTLVRKVQAYYPRDVPELRLTVDFETDARLHIKL
TDAASPRYEVPLEVPRATKRAENPLYILDFSREPFGILVKRRGSGVVLLNTSVAPLIFAD
QFLQISTLLPSEFVYGLGEHRHGFLHQLNWTTLTLWARDVPPTESYNLYGAHPFYLGLEP
TGASHGVFLLNSNAMEVVLQPAPALTWRTVGGILDLYVFLGPEPSSVIQQYQEVIGFPAM
PPFWGLGFHLCRWGYGSSNETWETVRAMRNYRIPQDAQWNDIDYMEGFRDFTFDPKNFGT
LPQLVADLHKHGQYYVMILDPGISSTQPQGSYPPYDDGLIRGVFINTTQGQPLIGQVWPG
LTAYPDFSNPETHQWWLENLKQFHTQVPFDGLWIDMNEPSNFKDGSVNGCPPGELDNPPY
KPAVLGGSLFAKTICASAEQRTSTHYNLHNLYGLMEAKATASALISIRGKRPFVISRSTF
PSQGKYSGHWLGDNRSEWKDMYWSIPGLLNFNLFGIPLIGADICGFSGSTSEELCTRWMQ
LGAFYPFARNHNTQGEKPQDPVVFSPLARTAMKEALLARYTLLPFLYTLFHRAHRWGDTV
VRPLFFEFPQDIVTYSLDRQFLWGRSLLVTPVLEAGVDAVIGYFPSGVWYDYYTGSSLYS
QGERLKLAAPLDHINVHVREGAVIPTQRPATTSWVSSGNPMSLLVALSQQGTAWGGLITL
NQTPKQAVQWLRDPSRNSTDKLKGQLTVHVDQRKLCENGNEAKGRGTNWGWDAEAFSTKA
DFLKPAEGIVFFEFTKCFVFQNTFTSNISNAHNILLVITSLQCVKMLDLENVTAPGSLDK
TKALRHTLSITVEGCMSPLKDEEPSATGMIAALGMTVKFISKSCPQGSSPHLAMAHHSHL
ALVFYDIRVTAELVQAESLLPPGLKAEGSATLLLLQFPISPEDEQSC
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctaccacaagctgcccttccgggagacccagatcaccgcagggccctttggg
gaggaggaggaagaggaggaggatgaggaggaagaagagcccccgaagcccgttggtcct
cccaagctgggtccactgctgtggtggctgggaagcgctcttctggctggagccgttctg
ctggggggagccgccttctgggccctcggccggcaggaggtggccgccccgcccccgaaa
tgcagctccgtgcccgaggcccaccgcttcgactgctatcccgaacgggacacggtcgtg
accgaggagctctgccggggccgggggtgctgcttcctgcaggacggtggctccgcgggg
ccgccctggtgcttttaccctcccgatttccccagctacaccctggagagcgtgaggcag
acagccgtcggcctggaagggacgctggtgaggaaggtgcaggcctactacccccgggac
gtgccggagctgcgcctgacagtggactttgagacggacgctcggctccacatcaagctg
accgacgccgccagcccaagatacgaggtgcccctggaggttccccgagccacgaagaga
gctgagaaccccctgtacatcctggacttctcccgggaaccttttgggatattggtgaaa
cgccgaggatcaggcgttgtgttgttgaacaccagcgtggctccgctcatctttgctgac
cagtttctccagatttccactctcctcccgtctgaatttgtctatgggctcggagagcac
cgccatggcttccttcaccagctgaattggaccaccctgactctctgggctcgggatgtc
ccccccacggagtcctacaacttgtatggggcccaccccttctacctggggttggagcca
accggagcgtcacacggggttttcctgctgaatagcaatgccatggaggtggtgctgcag
ccggctcctgccctgacttggagaactgtgggggggattctggatctctatgtcttcttg
gggcccgagcccagctctgtcatccagcagtatcaggaagtcataggtttccctgccatg
ccacctttctggggcctgggctttcatctgtgccgctgggggtacgggtccagcaacgag
acctgggagacagtccgagctatgaggaactaccggatccctcaggatgcgcagtggaat
gacattgactatatggaaggatttcgggatttcacctttgaccccaagaactttgggaca
cttccccagctggtggctgacctccacaagcacgggcagtactacgtcatgattctggac
cctggcatcagcagcactcagccgcagggttcctaccctccttatgatgatggtttgatc
cgaggagtcttcatcaacaccacccaggggcagccactgatcggtcaggtgtggccaggg
ctcactgcctatcctgacttctccaatccggaaactcatcagtggtggctggagaacctg
aagcagttccatactcaagttccttttgatgggctctggattgacatgaatgaaccttcc
aacttcaaggacggatcagtgaacggttgtcctcctggagaactggacaatccaccctac
aaaccagcggtgctgggaggctccttgtttgccaagaccatctgtgcctctgcagagcaa
agaacctctacgcattacaacctccacaacctttatggactgatggaagccaaagccaca
gctagtgccttgatctccatccgtgggaagcggccgtttgtgatctcccgctccaccttc
cccagccagggcaaatactcagggcattggctgggcgacaacaggagtgagtggaaggac
atgtactggtcaatcccaggtctgctcaacttcaatctctttgggatccccctgatcgga
gctgacatctgtgggttctcgggttccacttccgaggagctgtgcacccggtggatgcag
ctgggagccttttacccctttgctcggaatcacaacacccaaggcgagaagccccaggat
ccagtggtgtttagccctctggcccggaccgcgatgaaggaggccctgctggcccgctac
accctgctgcccttcctctatacgctcttccaccgggcccaccgctggggggacactgtg
gtgcgcccccttttcttcgagttcccccaggacatcgtcacctactctctcgatcggcag
ttcctgtggggtcgcagcctcttggtgacaccagtgctggaggcaggggtcgatgccgtg
attggctatttccccagtggcgtgtggtacgactactacacgggctcatctctgtacagt
cagggagaaaggctcaagttggcggctcccttggatcacataaacgtgcacgtccgggaa
ggagctgtcatccctacccagagaccagctaccaccagctgggtgagcagtggcaatccc
atgagcctgttggttgctctatcccagcagggcactgcctggggaggcctgataacattg
aaccagacccctaaacaggcagttcagtggctcagagaccctagccgcaatagcaccgac
aaactcaaaggacagctaacggtgcacgtggaccagaggaaactgtgtgagaacgggaac
gaagccaaagggcgagggaccaactggggttgggacgcggaggcattctccaccaaagcc
gactttctgaaaccagcagaagggatagtgttctttgagtttaccaagtgttttgttttt
caaaacactttcacatccaatatctcaaatgctcacaacatcttgctcgttatcacatcc
ttgcagtgtgtgaaaatgttagatctggagaatgtgactgctccaggttcattggataag
actaaagctctgagacacaccctgagcatcactgtggagggttgtatgtcccctctgaag
gatgaagaacctagtgccacaggcatgattgctgcccttgggatgacagtcaagttcatc
tctaaatcctgtccccaaggtagctctcctcaccttgcaatggcccatcatagccacttg
gcccttgtgttttatgacattcgagttacggcagaattagtgcaagcagagagtttgctg
cccccaggactcaaggcagaagggtcagccactctgctgctgctgcagtttcccatctct
cctgaagatgagcaaagctgctaa

DBGET integrated database retrieval system