KEGG   Ornithorhynchus anatinus (platypus): 100083131Help
Entry
100083131         CDS       T01045                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00020  Citrate cycle (TCA cycle)
oaa00190  Oxidative phosphorylation
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
oaa04714  Thermogenesis
oaa04932  Non-alcoholic fatty liver disease (NAFLD)
oaa05010  Alzheimer disease
oaa05012  Parkinson disease
oaa05016  Huntington disease
Module
oaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oaa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100083131 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100083131 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100083131 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100083131 (SDHA)
   05012 Parkinson disease
    100083131 (SDHA)
   05016 Huntington disease
    100083131 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100083131 (SDHA)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100083131 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100083131
NCBI-ProteinID: XP_028908876
LinkDB All DBs
Position
X2
AA seq 665 aa AA seqDB search
MSALRAGAGLQLGKRLALIRAKWPAAFQSVSRNFHLNVDGNKRASAKVSDSISTQYPVVD
HEYDAVVVGAGGAGLRAAFGLSEAGFKTACLTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEEGKIYQRAFGGQSLQ
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTFFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPEQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVNGKDQVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
AVPSIKANAGEESVANLDRLRFANGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKNLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RVDEYDFSKPIQGQQKRPFEEHWRKHTLSYVDTKTGKVTLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgcttcgggccggggcaggtttgcagctcgggaagcggctggctctgatcagg
gcgaaatggccagcagctttccaatctgtttcacggaactttcacttgaatgtggatgga
aataaaagagcatctgctaaggtttcagattctatttctacccagtatccagtagtggat
catgaatatgacgcagttgttgtcggtgctggtggagcaggtttgcgggctgcgtttggc
ttgtcagaagctgggtttaaaactgcatgtcttaccaagctcttccctaccagatcccat
actgttgccgcacaaggaggaatcaatgctgccctgggaaatatggaggaagataactgg
aggtggcatttttatgacaccgttaaaggttctgactggttgggagatcaggatgcaatt
cactacatgacagagcaagcacctgcttcagtggttgagctggaaaattatggcatgcca
tttagcagaacagaagaagggaagatttatcagcgagcatttggcgggcagagcctccag
tttgggaaagggggacaggctcatcggtgctgttgcgtggccgacaggacgggacattct
ctcttgcacactttgtatggaaggtcactgagatacgataccagctattttgtggagtat
tttgctttggatctcctgatggaaaatggagaatgtcggggtgttattgcattgtgcata
gaagatgggtccatacataggataagggcaaaaaatacagttgttgcaactggaggctac
ggacgcaccttctttagctgtacttctgctcataccagcactggtgatggcacagctatg
attacaagagcaggtctgccttgtcaggatttggaattcgtacagttccatcccacaggc
atatatggggcgggctgtctcatcactgaaggctgtcggggcgaaggaggcattctcatt
aacagtcaaggagaaagatttatggaaagatatgcacccgttgcaaaggacctggcatcc
agagatgttgtttcccgttctatgactattgagatccgtgaaggaagaggctgtggccct
gagaaggaccatgtgtatttgcagttgcatcatttaccgcctgagcagctagcctctcgc
ctgcctggcatctcagaaaccgcaatgatatttgctggggtcgatgtcaccaaggagcca
attcctgttcttcccaccgtgcattataatatgggaggcattcctacaaactacaaagga
caggtcctgaaacacgtgaatggcaaagatcaagttgtgcctggactctacgcttgtggt
gaagctgcgtctgcatcagtgcatggtgccaatcgactaggagcgaactctctcctggac
ctggtggtatttgggcgagcttgtgctttgagtattgcagaatcatgcaggcctggagat
gcggttccctccattaaagcaaatgctggggaagagtccgttgcaaatcttgacagattg
cgttttgcaaatggaagcataagaacgtcggaactcaggctcaatatgcagaagtcaatg
cagaatcatgcagctgtgttccgtgtaggaagtgtgctccaggagggttgtgagaaaatc
agccagctttatggtgacttgaagaatctgaagacatttgacagggggatggtgtggaat
acagatttggtggagacgttggaacttcagaatctcatgctttgcgctctgcaaactatt
tacggtgctgaagctcgcaaagagtcccgtggagctcatgccagggaggactacaaggtg
agggttgatgaatatgatttttccaagccaattcaagggcaacagaagagaccatttgag
gagcactggagaaagcatacactttcttatgtggataccaagactgggaaggtcactttg
gaatacagacctgtaattgataaaactttaaatgaagctgactgtgctactgtcccccct
gctattcgctcctattga

DBGET integrated database retrieval system