KEGG   Ornithorhynchus anatinus (platypus): 100084169Help
Entry
100084169         CDS       T01045                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00052  Galactose metabolism
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100084169
   00500 Starch and sucrose metabolism
    100084169
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100084169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110 GMC_oxred_N
Motif
Other DBs
NCBI-GeneID: 100084169
NCBI-ProteinID: XP_016082304
LinkDB All DBs
Position
Un
AA seq 772 aa AA seqDB search
RHQAGDRGPDPDRNAPGETGCRRDDLGSGIVVGLETGQSRVRLQVECSQVEEDVFRLKID
EEAPLKPRFEVPDVLPRSLATRGEPSPGGEEDLSTSSSQGKEEDLGLWEERWGPFVDVKA
NGPSSVGLDFSLPGFEHVYGIPQRAQSLQLPDTGGPGPGPAKKRAKCHTAVRWMSEGGVI
DVFLLMGPTPSAVFQQYGRLTGPPALPPLFSLGYHQCRWNYEDERDVRAVDAGFDGHDIP
YDALWLDIEHTEGKRYFTWDRQRFPDPTGMQDLLRGKRRKLVIITDPHIKVDPDYSLYSQ
AKAKGIFVKTAPGEDFECILLGQVKKATSVTGACSYLDFTNPEVRKWYADQFAFSTYKGS
TDVLFAWNDMNEPSVFRGPELTLPKDALHHGQREHRELHNIYGLYQQMATAAGLVQRSGG
EERPFVLTRSFFAGSQKYGAVWTGDNRAEWSYLKISIPMLLTLSIAGIPFCGADVGGFIG
DPDPELLVRWYQAAAFQPFFRGHANRDTKRREPWLLEPLHTRLIRETVRERYTLLPYWYS
LFYRAQETSVPVMRPLWVEFPTEPETFGAEEEYMLGNALLVHPVTDPGATSVNVFLPGPA
EVWYDFRTFARREGARTLEVPVTLESIPVFQRGGTVVPAKTSVGGSTGWMAEASYELRVA
LDSEASAVGELFLDDGHSFGYLRRNRYLRRKFSFQSGTLSSSCEDAKGKFHTDCVVERVL
ILGVDRKPSSVTTGPPGGKAREADFTYCAATSVLSLEKLRLAVGADWVVRVR
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
aggcaccaagcgggagaccgaggcccggatcccgaccgaaatgccccgggcgaaacggga
tgtcgccgggacgatctgggttcaggcatcgtcgttggcctggagacggggcagagccga
gtccgtctgcaggtggaatgctcccaagtagaggaagacgttttccggctgaaaatcgac
gaggaggctcccctgaagccgaggtttgaggtccccgacgtcctcccgagatccctggcc
accagaggggaaccttcccccggaggagaggaagacctatcgaccagctcctcccagggg
aaggaagaggacctgggcctctgggaggagaggtggggcccgttcgtcgacgtcaaggcc
aacggccccagctccgtaggcctggatttctccctgcccgggttcgagcacgtctacggg
atcccgcagcgtgcccagagcctccagctgccggacaccggcggccccggccccggcccc
gctaagaagagagccaagtgccacacggccgtccgctggatgtcggagggcggcgtcatc
gacgtcttcctgctgatgggacccacgccttcggccgtcttccaacagtacgggcggctc
acgggcccgccggccctgcctccgctcttctccctggggtaccaccagtgtcgctggaac
tacgaggacgagcgggacgtgagggccgtggacgcgggcttcgacggccacgacatcccc
tacgacgctctgtggctggacatagaacacaccgagggcaagcggtacttcacctgggac
cggcagaggttcccggaccccaccgggatgcaggacctgctgaggggcaaaaggcggaag
ctggtcatcatcaccgacccccacatcaaggtggatcccgattactccctctactctcag
gccaaagcgaagggcatttttgtgaaaacagcgcccggtgaagatttcgaatgcattctg
ctgggccaggttaaaaaagcgacttctgtcactggcgcctgctcctacctggacttcacg
aaccctgaggtccgcaagtggtacgcggaccagtttgccttctctacgtacaagggctcc
actgacgtcctcttcgcctggaacgacatgaacgagccctcggtcttccgggggccggaa
ctgaccctgccaaaggacgccctccaccacggccagcgggaacaccgagagcttcacaac
atctacggcctttaccagcaaatggcgacggccgcggggctggtgcagaggtccggcggg
gaggagagacccttcgtcctcacgcgctccttcttcgccggctcccagaagtacggcgct
gtgtggaccggagacaacagagcggagtggagttacctgaaaatctccatccccatgttg
ctcacgctcagcatcgccgggatcccgttctgcggagctgacgtaggcggtttcatcggg
gacccggacccggaattgctggtacgctggtaccaggccgcggccttccagcccttcttc
cgcggccacgccaaccgggacaccaagaggcgggagccctggctgctggagcccctgcac
acccgcctcatccgagagaccgtcagagagcgctacaccctcttaccctactggtattcc
ctcttctaccgggcgcaggagacctcggtgcccgtcatgaggcccctgtgggtggagttc
cccacggaaccggagacgttcggggcggaagaggagtacatgctggggaacgctctgctg
gtgcatccggttacagacccaggggccacctccgtgaacgtgtttctgcctgggccagcg
gaggtctggtacgacttccggacgttcgctcgtcgggaaggggctcgcaccctggaggtc
cccgtcaccttggagagcatcccggtgttccagcgcggtggcaccgtggtgcccgccaag
acctccgtgggcggatcgaccggctggatggccgaagcgtcctacgagctgcgagtggcg
ctcgattctgaggcctctgccgtgggcgagctcttcctcgacgacggacattctttcggc
tacctccgtcggaaccggtacctgcgtaggaagttttcgttccagtcaggcaccctctcc
tccagctgtgaggacgccaaggggaaattccacaccgactgcgtggtggagcgggttctg
atcttgggggtcgacaggaagccgtcctcagtgaccaccggcccccccggtgggaaagcc
cgggaagcggatttcacgtactgcgccgccacctccgtgctctccctggagaagctccgg
ttggccgtgggcgccgactgggtggtccgcgtcaggtga

DBGET integrated database retrieval system