KEGG   Ornithorhynchus anatinus (platypus): 100084432
Entry
100084432         CDS       T01045                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04020  Calcium signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04144  Endocytosis
oaa04151  PI3K-Akt signaling pathway
oaa04510  Focal adhesion
oaa04540  Gap junction
oaa04630  JAK-STAT signaling pathway
oaa04810  Regulation of actin cytoskeleton
oaa05163  Human cytomegalovirus infection
oaa05200  Pathways in cancer
oaa05206  MicroRNAs in cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05218  Melanoma
oaa05230  Central carbon metabolism in cancer
oaa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100084432 (PDGFRA)
   04014 Ras signaling pathway
    100084432 (PDGFRA)
   04015 Rap1 signaling pathway
    100084432 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100084432 (PDGFRA)
   04020 Calcium signaling pathway
    100084432 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100084432 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100084432 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100084432 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100084432 (PDGFRA)
   04540 Gap junction
    100084432 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100084432 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100084432 (PDGFRA)
   05206 MicroRNAs in cancer
    100084432 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100084432 (PDGFRA)
   05231 Choline metabolism in cancer
    100084432 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100084432 (PDGFRA)
   05218 Melanoma
    100084432 (PDGFRA)
   05215 Prostate cancer
    100084432 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100084432 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100084432 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100084432 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oaa04090]
    100084432 (PDGFRA)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100084432 (PDGFRA)
Protein kinases [BR:oaa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100084432 (PDGFRA)
CD molecules [BR:oaa04090]
 Proteins
  100084432 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE
Other DBs
NCBI-GeneID: 100084432
NCBI-ProteinID: XP_028932296
LinkDB
Position
12
AA seq 1089 aa
MGPSPWTCLILGYLLSGLRRGACQPPFPTIVPDEEELVVSLHMSFSLRCTGDSEVSWQFP
TLDDGSPGVSVRSEENNSGSFVAVLEVANASAVHTGLYTCYYNHTQTQEAEAEGRDVYVY
VPDPDVAFVPSVMVDHFIVVEEDDSTVIPCRSTDPQARVTLHASDGKEVSAFYDSRQGFL
GHFDMGSYTCETTIRGRKFQTLEFNVYTLRATPEIVVEMEAPKTVYKTGETIVVTCAVLD
NEVVDFQWNYPGKVRDKGIIKLDEIKVPSIKLVYTLTVPEATAKDGGDYECAARHATKEA
KQIKKVTITVHERGFVRLQPGFGPVEAVNLHEVRHFGVELEAYPPPRVSWLKNDVSLTEN
LTEITTSLEKIQEIRYQSKLKLIRAKEEDSGHYTIVVQNEDDIMNYTFELLVQVPASILD
LVDDHHGSAGGQTVRCVAEGTPLPDVDWMVCRDIKKCNNETSWTLLTANASDIAVEAHVG
DRDTMESQVTFQQVEETLAVRCLAKNHLGAVTRELKLVAPALRSELTVAAAVLVLLVIVI
VSLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRIL
GSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVN
LLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLTRHPEKTKKELDIFGMSPADESTRS
YVILSFENNGDYMDMKQADATQYVSMLERKESSKYSDIQRSLYNRPASYKKKSVSDSEVT
DLLSDDGSEGLGLLDLLSFTYQVSRGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGL
ARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
MVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGHYK
KSYEKIHRDFLKSDHPAVARMRVESDEPYVGVTYKNEEKLKEWESGLDEQRLSADSGYII
PLPDLEPGLEDELGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDLMDDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atgggtccttccccatggacatgcctgatcttggggtatctgctgtcagggctacgacgc
ggggcctgccagcccccgtttcccaccatcgtgccggacgaggaggagctggtggtgtcc
ctgcacatgtccttctccctgcggtgcaccggggacagcgaggtcagctggcagttcccc
acgctggacgatgggagccccggcgtgtccgtccgcagtgaggagaacaacagcggctcc
ttcgtggccgtgctggaggtggccaacgcctcggccgtgcacaccggcctctacacctgc
tattacaaccacacgcagacccaggaggccgaggccgaaggccgggatgtctacgtctac
gtgcctgaccccgacgtcgccttcgtgccctcggtcatggtcgaccacttcatcgtcgtg
gaggaagacgattccaccgtgatcccctgtcgctccaccgacccgcaggcgcgggtgacc
ctgcacgccagcgacggcaaggaggtctctgccttctacgacagccgccaaggtttcctg
ggtcacttcgacatggggtcctacacgtgcgagacgaccatccgcggcaggaagttccag
accctcgagttcaacgtctacaccttgcgagccaccccggagatcgtcgtggagatggag
gccccgaagacggtgtacaagacgggcgagaccatcgtggtcacctgcgccgtcctggac
aacgaggtggtcgatttccagtggaactacccggggaaggtgagggacaagggcatcatc
aagctggacgagattaaggtcccgtccatcaagctggtgtacaccctgacggtgcccgag
gccacggccaaggacggcggcgattacgagtgtgctgcccgccacgccaccaaggaggcg
aagcagataaagaaggtcaccatcaccgtccacgagagaggcttcgtccggctccagccc
ggcttcggccccgtggaggccgtgaacctgcacgaggtccggcattttggcgtggagctg
gaggcctaccccccgcccagggtgtcctggctgaagaacgacgtgtcgctcaccgagaac
ctgaccgagatcaccaccagcctggagaagatccaggagatcaggtatcagagcaagctg
aagctaatccgagcaaaggaggaagacagtgggcactacacaatcgtggtgcaaaacgag
gatgatattatgaactacacctttgagctgctggttcaagtgccggcctccatcttggat
ctggtggacgaccaccatggctcggcggggggccagaccgtccgctgtgtcgccgaaggg
acgccgctgcccgacgtcgactggatggtttgcagggacattaaaaaatgcaacaacgag
acctcgtggaccctcctcaccgccaacgcgtccgacatcgccgtggaggcccacgtgggt
gacagggacacgatggagagtcaggtgaccttccagcaggtggaggagacgctggcggtg
cgctgcttggccaagaaccaccttggggccgtgacgcgggagctgaagctggtggcccct
gccctgcgctctgagttgaccgtggctgctgccgtcctggtgctcctggtgatcgtcatc
gtctccctcatcgtgctggtcatcatctggaaacagaagccgcgctatgagatccgatgg
cgggtcatcgagtccatcagcccggacggccacgagtatatctacgtggacccgatgcag
ctcccctacgactcgcgctgggagtttccgagggacgggctggtgctgggccgaatcctt
gggtccggagcatttgggaaggtggtggaaggcactgcatacgggctgagccgctcccag
cccgtgatgaaggtggccgtgaaaatgttaaaacccacggctcgatccagcgagaagcag
gccctcatgtcggagctgaagatcatgacgcatctgggcccccatctgaacatcgtgaac
ctcctgggggcctgcaccaaatcaggacccatctacatcatcaccgagtactgcttctac
ggcgacctggtcaactacctgcacaagaaccgcgataacttcctgactcgccacccggag
aagacgaagaaagagctggacatcttcggcatgagccctgccgacgagagcaccaggagc
tacgtcatcctctcatttgaaaacaacggggactacatggacatgaagcaggcggacgcc
acgcagtacgtgtccatgttggagaggaaggagtcgtccaagtactcggacatccagcga
tccctgtacaaccggccggcctcctacaagaagaagtccgtgtcggactctgaagtcacg
gacctcctgtcggacgatggttcggaaggccttggcctgctggacctgctgagctttacc
taccaggtgtctcgcgggatggagttcctagcttcgaaaaactgcgtccaccgggatctg
gctgcgcggaacgtcctgctggcccaagggaagatcgtgaagatctgcgacttcgggctg
gcgagggacatcatgcacgactccaactacgtgtccaagggcagcacgttcctgcccgtg
aaatggatggccccggagagcatcttcgacaacctgtacaccacgctgagtgatgtctgg
tcttacgggatcctgctgtgggagatcttctctctcgggggtacgccctacccgggcatg
atggtcgactccaccttctacaacaagatcaagagcggctaccgcatggccaagccggac
cacgccaccagcgaggtgtacgagatcatggtcaagtgctggaacagcgaacccgagaag
agaccgtccttctaccacctgagcgagatcgtggagagcctgctgcccggccactacaag
aagagctacgagaaaatccaccgggacttcctgaagagcgaccacccggccgtggcccgg
atgagagttgagagcgacgagccgtacgtgggggtcacctacaagaacgaggagaagctc
aaggagtgggagagcggcttggacgagcagaggctcagcgccgacagcggctacatcatc
cctctgccggacctcgaacccggcctggaggacgaactcggcaagaggaaccggcacagc
tcccagacgtccgaggagagcgccatcgagacgggctccagcagctcgaccttcgtcaag
agggaggacgagaccatcgaggacatcgacctgatggatgacgacatcggcatcgactcg
tcggacctggtggaggacagcttcctgtag

DBGET integrated database retrieval system