KEGG   Ornithorhynchus anatinus (platypus): 100085175Help
Entry
100085175         CDS       T01045                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100085175 (SUV39H2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100085175 (SUV39H2)
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100085175 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100085175 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo IGPS
Motif
Other DBs
NCBI-GeneID: 100085175
NCBI-ProteinID: XP_007655123
UniProt: F6VDM6
LinkDB All DBs
Position
Un
AA seq 405 aa AA seqDB search
MTYTVAWCVPCLASFDTLQELCRKEKLTCKSIGITKRNLNNFEVEYLCNYKVEKDMEYYL
VKWKGWPESTNTWEPLENLKCPLLLKQFFNDQRVYLTKMKQGKVITLKNNVKILRPALAK
YIVKKAKQRIALQRWQEELNRKKNHDGMIFVENTVDLEGPPIDFYYINEYKPAPGINLVS
EATVGCVCTDCFFEKCCPAEAGVHLAYNKNNQIKIQPGTPIYECNSQCQCGPDCPNRIVQ
KGTQYSLCIFRTSNNCGWGVKTLEKIKRMSFVMEYVGEVITSEEAERRGQLYDDKGITYL
FDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTIKAG
EELTFDYQMKGSGDLSSESIDLSPAKKRVRTVCKCGSVSCRGYLN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacctatactgtagcttggtgtgtgccatgtctagcttcatttgacaccctccaggaa
ttgtgtagaaaagaaaaactcacatgtaaatcgattggaatcaccaaaaggaatctaaac
aattttgaggtggaatacttgtgtaactacaaggtagaaaaggatatggaatattacctt
gtaaagtggaaaggatggccggagtccacaaacacctgggagcctctggaaaatctcaaa
tgtccattgcttcttaaacaattctttaatgaccagcgtgtgtatttgacaaagatgaag
caagggaaagtaataactctaaagaacaatgttaagattttgaggcctgcgcttgccaag
tatatcgtaaagaaggcgaaacaaaggatagctctgcagaggtggcaagaagaactcaac
cgaaaaaagaaccacgatggaatgatatttgtcgaaaacactgtggacctggagggtccc
ccgatagacttctactacattaatgaatataaacccgcccccgggatcaatttagtaagc
gaagccacagtcggctgtgtttgcactgactgcttctttgaaaagtgttgcccggccgaa
gctggagttcacttggcatataataaaaacaaccagatcaaaatccagccaggcaccccc
atctacgaatgcaactcccagtgccagtgcggacccgactgcccaaatcggatcgtgcag
aaaggcacgcagtactcactgtgcatctttcgaactagcaacaactgtggctggggagtg
aaaaccctggagaaaattaagaggatgagtttcgtcatggagtatgtcggagaggtaatt
acaagtgaggaagcagagagaagaggacagctctatgacgataaaggaatcacatatctc
tttgatttggactatgaatctgatgaatttacagtggatgcagcgcgatatggaaatgtg
tcacattttgtgaatcatagttgtgacccaaatctccaggtattcaatgtcttcatcgat
aatcttgatactcgtcttcctcggatagcattattttctaccagaacaataaaggctgga
gaagaactcacgtttgattaccagatgaaaggttctggagacttgtcttctgagtccatc
gacctcagtccagccaaaaagagagtcagaactgtgtgcaagtgtggttctgtgtcttgc
agaggttacctcaactaa

DBGET integrated database retrieval system