KEGG   Ornithorhynchus anatinus (platypus): 100085380Help
Entry
100085380         CDS       T01045                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100085380 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100085380
NCBI-ProteinID: XP_028926569
LinkDB All DBs
Position
8
AA seq 586 aa AA seqDB search
MAARPAALREPGLRLLPLLLLLLLGPGARAEAARDDLREELVVTPLPSGDVAATFQFRTR
WDSELQREGVSHYRLFPKALGQLISKYSVRELHLSLTQGFWRTRYWGQPFLQAPAGAELW
AWFQPSVTDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLVNATDHRLLRY
AVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKAERLFHSSYHSQAVHIRPVCRDARCTS
VSWELRQTLTVVFDAFTAGQAKRDWSLFRMFSRTLTEACPLATQSRVYVDVSGGAQDGEA
PEVSPPPGDTYRAVVLGERRTYAVFDLLDPATFNSSRSLNLQLKCKRPRDGAAPLPVPFL
HAQRYVSGYGLQQGELSTLLYNTHSYRAFPVLLLETVPWYLRLYVHTLVITTKGKENKPS
YIHYQPAQDRRRPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLS
ALVPSVVGVETADWEESPLFATLFPVSDGSSYFVRLYTEPLLVNLPTPDFSMPYNVICLT
CTVVAVCYGSFYNLLTRTFHLEVPSRGGLAKRLANLIRRARGVPLL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggccggccgccctgagggagccggggttgcggttgctcccgctgctgctg
ctgctgctgctggggcccggggcccgggcggaggccgcgcgggacgatctgcgcgaggag
ctggtggtcaccccgctgccctcgggggacgtggccgccaccttccagttccgcacgcgc
tgggactcggagctgcagcgggagggagtgtctcactacaggctgttccccaaggccctg
gggcaattgatctccaagtactcggtgcgagagctgcacctgtcgctgacccaaggcttc
tggcggacccgctactggggccaacccttcctgcaggctccggccggcgccgagctctgg
gcctggttccagccttctgtcaccgatgtcgataagtcctggaaggagctcagcaacgtc
ctctctgggatcttctgcgcctcccttaacttcatcgactccaccaataccgtcaccccc
acggcttccttcaaacccttggggctggtcaacgccacggatcaccggctcctgcgttac
gccgtcctgccccgcgaggtggtctgcaccgagaacctcaccccgtggaagaagctgttg
ccctgcagctccaaggccggcctctcggtgctgctcaaagccgagcgtctgttccacagc
agctatcactcccaggccgtgcacatccgccccgtgtgcagagacgcccgctgcaccagc
gtctcctgggagctgaggcaaacgctgacggtcgtcttcgacgccttcaccgcggggcag
gcgaagagagactggtcgctcttccgcatgttctcccgcaccctgacggaggcctgcccc
ctggccacgcagagccgcgtctacgtggacgtctccggcggcgcccaggacggcgaggcc
ccggaggtgagcccgccccccggggacacctaccgagccgtcgtcctcggggagcggagg
acctacgccgtcttcgacctgctggacccggctaccttcaacagctcccggagcctcaat
ctccagctcaagtgcaagcggccccgggacggggctgctcccctcccggtgcccttcttg
cacgcgcagcgctacgtgagcggctacgggctgcagcagggggagctgagcaccctgctg
tacaacacccactcctaccgggccttccccgtgctgctcctcgagacggtgccctggtac
ctgcgcctctacgtccacacgctggtcatcaccaccaagggcaaggagaacaagccgagc
tacatccactaccagccggcccaggaccgacggcggccccacctcctggagatgctcatc
cagctcccggccaactccgtcaccaaggtgtccatccagtttgagcgcgccctgctcaag
tggaccgaatacacccccgatcccaaccacggcttctacgtcagcccgtcggtgctcagc
gccctggtgcccagcgtggtgggggtcgagacggccgactgggaggagagccctctgttc
gccacgctgttccccgtgtccgacgggtccagctacttcgtccgcctgtacacggagccc
ctgctggtgaacctgccgacgccggacttcagcatgccctacaacgtcatctgtttgacc
tgcaccgtggtggccgtgtgctacggctccttctacaacctcctgacccgcaccttccac
ctggaggtgcccagccggggcggcctggccaagcgcctggcaaacctgatccgccgggcc
cgcggcgtcccccttctctga

DBGET integrated database retrieval system