KEGG   Ornithorhynchus anatinus (platypus): 100085443Help
Entry
100085443         CDS       T01045                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00010  Glycolysis / Gluconeogenesis
oaa00051  Fructose and mannose metabolism
oaa00052  Galactose metabolism
oaa00500  Starch and sucrose metabolism
oaa00520  Amino sugar and nucleotide sugar metabolism
oaa00524  Neomycin, kanamycin and gentamicin biosynthesis
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
oaa04066  HIF-1 signaling pathway
oaa04910  Insulin signaling pathway
oaa04930  Type II diabetes mellitus
oaa04973  Carbohydrate digestion and absorption
oaa05230  Central carbon metabolism in cancer
Module
oaa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oaa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100085443 (HK1)
   00051 Fructose and mannose metabolism
    100085443 (HK1)
   00052 Galactose metabolism
    100085443 (HK1)
   00500 Starch and sucrose metabolism
    100085443 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100085443 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100085443 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100085443 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100085443 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100085443 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100085443 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100085443 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oaa04131]
    100085443 (HK1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100085443 (HK1)
Membrane trafficking [BR:oaa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100085443 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 CSD
Motif
Other DBs
NCBI-GeneID: 100085443
NCBI-ProteinID: XP_007654508
LinkDB All DBs
Position
Un
AA seq 867 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDVMDRFSKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSCFRILRVKVSHEKKQTVQMETEIYDTPEDVMH
GSGSQLFDHVAECLGDFMEKKQIKDKKLPVGFTFSFPCRQSRIDEGVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYNADIVAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
ELRHIDSVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCAIVSFRSANLVATTLGAILTRLRDNKGVARLRTTVGVDGSLYKMH
PQYSRRFHKTLRRLVPESDVRFILSESGSGKGAAMVTAVAYRLAEQHRLIEETLAEFKLT
HEQLLQVKRRMRVEIEAGLQKKSHESAKVKMLPTFVRSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGQDVANLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGRYCQNFCYCHGYEKMISGMYLGEIVRNILIDFTKRGFLFRG
QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNGTCDDSILVKTVCGTVSRRA
AQLCGAGMAAVVDKIRENRGLDHLEVTVGVDGTLYKLHPHFSRIMHQTVKDLAPKCNVTF
LLSEDGSGKGAALITAVGVRLRDGGQS
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcgcagctcctggcttattattttacagaattaaaggatgatcaggtcaaa
aagattgacaagtatctctatgccatgcggctctcagatgaaaccctgctggacgtcatg
gatcgctttagcaaggaaatgaagaacggcctttccagggattttaatccaacagccacc
gtcaagatgctgccgacctttgtgcgatccattcctgatgggtcagaaaagggagatttc
attgccctggaccttggtggatcttgctttagaatcctgcgggtgaaggtgtcgcatgag
aaaaagcagactgtgcagatggagacggagatttatgatacccctgaggacgtcatgcat
ggcagtgggtctcagctttttgatcacgttgctgagtgcctgggagacttcatggagaaa
aagcaaatcaaggataagaaactccccgttggatttacattttctttcccatgcagacaa
tcacgaatagacgagggtgttctgatcacctggacgaagcgcttcaaagccagtggagtc
gaaggtgcagatgtggtaaagttgctcaacaaggccatcaagaaacgtggggactataat
gcagatattgtggctgtggtgaacgacacagtaggaaccatgatgacctgtggtttcgat
gaccagcgctgcgaagttggcctgataattggtaccggcaccaacgcctgctacatggaa
gagctgagacacattgactcggtggaaggagatgagggaagaatgtgcatcaacacagag
tggggggcctttggagacgatgggtccttagaagacatcaggacagaatttgacagagag
atcgaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagcggcatg
tacatgggagaactggtcaggttgattctcgtgaagatggcaaaggaggggctcctcttt
gaggggagaataactccggagctgttaaccaaagggaaatttgagacaaagcacgtatct
gccatagaaaagagcaaagaaggactcaataaagccaaagagattctcacccggctgggg
gtggaaccatcccatgaagactgcatcgccgtccagcacgtgtgcgccatcgtttcgttc
cggtcggccaatctggtagccaccacgctgggggccatcctcacccgcctgcgggataac
aagggcgtcgcgaggctgcggaccacagtcggtgtagacggctccctttacaagatgcac
ccgcaatattctcggcgtttccataagaccctcagacgcctggtccccgagtccgacgtg
cgcttcatcctctcggagagcggcagtgggaagggagctgccatggtgacggcggtggcc
taccggctcgccgagcagcaccggctgatcgaagagacgctggccgagttcaaactcacc
cacgagcagctgctgcaggtgaagaggaggatgcgggtggagatcgaggccggactgcag
aagaagagccacgagtcggccaaagtcaagatgttgcccacgttcgtccgcagcaccccc
gacgggtctgaaaacggggatttcttagcccttgaccttggaggaacaaacttccgagtc
ttgttagtgaagatccgcagtgggaagcggaggacagttgaaatgcacaacaaaatctat
gccattcccattgaagtcatgcagggcacaggagaggagctgtttgatcacattgtccac
tgcatctctgatttcctggattacatggggataaagggggctcggctgcctctgggcttt
accttttcctttccctgcaagcagacaagtctagatgcgggtatcctactcaactggaca
aaaggctttaaggcaacagattgcgaaggacaggatgtggccaatctgctgagagaagga
attaaaagaagagaggaatttgacctggatgttgtggccgtggtgaatgacaccgtgggc
accatgatgacctgtgcatacgaagagccaacctgtgaagtcggactcattgtgggtagg
tactgtcaaaatttttgctactgtcatgggtatgagaaaatgatcagtggaatgtaccta
ggagaaatcgtccgcaacattttgatcgacttcaccaaaagaggatttctcttcagaggc
cagatctccgagacgctgaagaccaggggcatatttgaaacgaagttcctttcccagatt
gagagtgataggttagctttgcttcaagtccgggcgatcctgcagcagctggggctgaac
ggcacctgcgacgacagtattttggtgaagacggtctgcggcacggtgtccaggagagca
gcacagttgtgtggagctgggatggccgcagtggtagataagatcagggaaaacagagga
ctagaccacctggaggtgacggtcggggtggacggaacactctacaagctccatccacac
ttctccaggatcatgcaccagacagtgaaggacctggcgcccaagtgtaacgtgacattc
ctcctctcagaagacggcagcgggaaaggggcggcgctcatcacagcggtgggcgtgagg
ctgcgggacggcggtcagagctaa

DBGET integrated database retrieval system