KEGG   Ornithorhynchus anatinus (platypus): 100085554Help
Entry
100085554         CDS       T01045                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04064  NF-kappa B signaling pathway
oaa04210  Apoptosis
oaa04380  Osteoclast differentiation
oaa04625  C-type lectin receptor signaling pathway
oaa04660  T cell receptor signaling pathway
oaa04668  TNF signaling pathway
oaa04672  Intestinal immune network for IgA production
oaa05166  Human T-cell leukemia virus 1 infection
oaa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100085554
   04064 NF-kappa B signaling pathway
    100085554
   04668 TNF signaling pathway
    100085554
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100085554
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100085554
   04660 T cell receptor signaling pathway
    100085554
   04672 Intestinal immune network for IgA production
    100085554
  09158 Development
   04380 Osteoclast differentiation
    100085554
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    100085554
   05169 Epstein-Barr virus infection
    100085554
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100085554
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100085554
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: STE group
  Other
   100085554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100085554
NCBI-ProteinID: XP_001515861
LinkDB All DBs
Position
Un
AA seq 402 aa AA seqDB search
MTSPKLVPLYGAVKEGSWINIFMELMDGGSLGQLIKQKGRLPEDRALYYLGQTLEGLEYL
HARRILHGDVKADNVLLSGDGSLAFLCDFGHSTHLQPHGLGTSLVTGRYVPGTETHVAPE
VVMAKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKIAQGPPPVREIPPSCAPLT
ADAIREGLEKEPAHRASAAELRPRVGRALQQVGGLRSPWRGEYREPRRLAVNAESPPDTE
AARPAPIRPVPPASPAPGPAAGVTGGTRKLQPPVPPEPPERNPAPPPGPGKEDSGSWGPR
PLSSLGPGPAKSPGPGERRVTVSDQELQQLEIELFLNSLSQPYSLEEQEQMLSCLSIDSL
SLSDASEKNSSRVSQSLRDNLSSGVHSWNSQADGQTFSWNNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccccaagctcgtccccctgtacggcgccgtgaaggaagggtcttggatcaac
atcttcatggagctgatggacggcggctccctgggccagctgatcaagcagaagggccgc
cttcctgaagaccgagccttgtattacctggggcagaccttggaggggctggaatacctt
cacgcccgccgcatcctccacggagacgtgaaggcagacaacgttctcctgtcaggggac
gggagcctggccttcctgtgtgactttggccactccacccacctgcagccccacggcctg
gggacgtccctggtgaccggacgctacgtccccggcacggagacccacgtggctccggag
gtggtgatggccaaacgctgcgactccaaggtggacgtgtggagcagctgttgcatgatg
ctgcacatgctcaacggctgccatccctggactcagtactacaatcaccccctctgtctc
aagatcgcccaggggcctccgccggtgagggagatcccgccgtcctgtgcccccctcacc
gccgacgccatccgggaggggctggagaaggagcccgcgcaccgagcctccgccgcagag
ctgcgcccgcgagttggccgggccctgcagcaggtgggtgggctgagaagcccctggaga
ggagaatacagggagccgaggcgtttggccgtcaacgcggaatcgccgccggacacggag
gctgcacgcccggcccctatccggccggttcccccggcctcacccgcgccgggaccggcc
gccggggtgacgggcgggacccggaaacttcaaccccccgtaccgccagagccaccggaa
cggaacccggcgccgcccccggggccgggcaaggaggactctgggagctgggggccccgg
cccctctcctccctgggccccggccccgccaagagccccggccccggcgagcgcagagtg
accgtctctgaccaggagctgcagcagctggagatagagctctttctgaacagcctgtct
cagccgtactccctggaagagcaggagcagatgttgtcgtgtctcagcatcgacagcctg
tccctgtccgacgccagcgagaagaactcgtcgagggtctcgcagagtctccgcgacaac
ttgagctccggggttcactcgtggaacagccaggcggacgggcagaccttcagctggaac
aacctt

DBGET integrated database retrieval system