KEGG   Ornithorhynchus anatinus (platypus): 100086096Help
Entry
100086096         CDS       T01045                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00590  Arachidonic acid metabolism
oaa01100  Metabolic pathways
oaa04064  NF-kappa B signaling pathway
oaa04370  VEGF signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04657  IL-17 signaling pathway
oaa04668  TNF signaling pathway
oaa04723  Retrograde endocannabinoid signaling
oaa04726  Serotonergic synapse
oaa04913  Ovarian steroidogenesis
oaa04921  Oxytocin signaling pathway
oaa04923  Regulation of lipolysis in adipocytes
oaa05140  Leishmaniasis
oaa05163  Human cytomegalovirus infection
oaa05165  Human papillomavirus infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05200  Pathways in cancer
oaa05204  Chemical carcinogenesis
oaa05206  MicroRNAs in cancer
oaa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100086096 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100086096 (PTGS2)
   04064 NF-kappa B signaling pathway
    100086096 (PTGS2)
   04668 TNF signaling pathway
    100086096 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100086096 (PTGS2)
   04657 IL-17 signaling pathway
    100086096 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100086096 (PTGS2)
   04913 Ovarian steroidogenesis
    100086096 (PTGS2)
   04921 Oxytocin signaling pathway
    100086096 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100086096 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100086096 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100086096 (PTGS2)
   05206 MicroRNAs in cancer
    100086096 (PTGS2)
   05204 Chemical carcinogenesis
    100086096 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100086096 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100086096 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100086096 (PTGS2)
   05165 Human papillomavirus infection
    100086096 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100086096 (PTGS2)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100086096 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100086096
NCBI-ProteinID: XP_007667187
UniProt: F6QEB1
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARLLCFALAITLCPAANPCCSNPCQNRGVCTTVGFDRYRCDCTRTGYYGENCTAPEFL
TRLKLLLKPTPNTVHYILTHFKGVWNIINNMPFLRNAIMSYVLTSRSHLIDSPPTYNANY
GYKSWEAYSNISYYTRALPPVGADCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHHRGPAFTKALNHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QMIDGEMYPPTVKDTQAEMIYPPHIPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLTQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFNIHDQVYTYQQFLYNNSIMLDHGLSRMVESFSRQIAGRV
AGGRNVPPAVMKVSMASIDQSRQMRYQSLNEYRKRFLLKPFKSFEDLTGEKDMAAELEAL
YGDIDAMELYPALLVEKPRPGAIFGETMVELGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFEIINTASLQTLICNNVKGCPFTSFSVRDSNPAETATSNASSANSGLDDINPTVLLKER
SSEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcacgcctcctgtgcttcgccttggccatcacgctgtgcccagcagccaaccca
tgctgctccaacccctgtcagaatcgaggtgtgtgtacgaccgtgggattcgaccggtac
aggtgcgactgtacgaggaccggctattatggagaaaactgcaccgcacccgaatttctg
acaaggctaaagttattattgaaacccacccccaacacggttcactacatcctcactcac
ttcaaaggagtttggaatatcatcaataacatgcccttccttcgtaatgcaattatgagc
tacgtgttgacgtcgaggtcccatttgattgacagtccaccgacatacaatgcaaattat
ggctacaaaagctgggaagcctattcaaacatctcttattacaccagagcacttcctcca
gtgggagctgactgcccaaccccaatgggtgtcaaaggtaagaaggagcttcccgattcc
aaagagattgtggaaaagtttctgctgagaagaaaatttatcccagatcctcaaggcaca
aatatgatgttcgcgttctttgcgcagcacttcactcaccagttctttaagactgaccat
catcgaggaccggccttcaccaaagcactaaaccatggcgttgatttaaatcatatttat
ggagagactttggacagacagcataaactgagactttttaaggatggaaaaatgaaatat
cagatgattgatggagaaatgtaccctcccactgtgaaagatactcaggcagaaatgatt
tacccacctcacatccccgagcacctgcggttcgccgtcgggcaggaggtgttcggcctg
gtccccgggctgatgatgtacgccacgatatggctccgggaacacaaccgcgtgtgtgac
gtccttacgcaggagcacccggagtgggacgacgagcgcttgttccagacgacccggctc
atactgataggtgaaaccattaagatcgtgatcgaagactatgttcagcacttgagtggc
tatcacttcaaactgaagtttgatccggagctgctttttaaccagcgtttccagtatcag
aatcgcatcgccgccgagtttaacaccctctaccactggcacccgcttctgcccgacacc
ttcaatattcacgaccaggtgtacacctaccagcagttcctttacaacaactctatcatg
ctggaccacggcctttcccgtatggtggaatcgttctcgcggcaaattgccggcagggtg
gccgggggtaggaacgtcccacctgcggtaatgaaagtgtctatggcctcgatcgaccag
agcagacagatgagataccaatctctgaacgaataccggaaacgcttcctgctgaaacct
ttcaagtcgttcgaagaccttaccggggagaaagacatggctgccgagttggaagccctc
tacggcgatatcgatgcgatggagctgtatcctgctcttctggtggaaaaaccccgcccg
ggagccatctttggtgagaccatggtggaactgggagcgccgttctccctgaaagggctc
atgggcaatcccatctgttctcccgaatactggaagcctagtacttttggaggagaagtg
ggctttgaaatcatcaacacagcctcgctccagacgctgatctgcaataacgtgaagggc
tgccccttcacctcgttcagtgttcgcgactctaatcccgccgagacggcgactagtaac
gccagctccgccaactctggactagatgatatcaatcctaccgtactactgaaagaacgg
tcatcagaactgtag

DBGET integrated database retrieval system