KEGG   Ornithorhynchus anatinus (platypus): 100086380Help
Entry
100086380         CDS       T01045                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04015  Rap1 signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04068  FoxO signaling pathway
oaa04150  mTOR signaling pathway
oaa04270  Vascular smooth muscle contraction
oaa04510  Focal adhesion
oaa04650  Natural killer cell mediated cytotoxicity
oaa04720  Long-term potentiation
oaa04722  Neurotrophin signaling pathway
oaa04726  Serotonergic synapse
oaa04730  Long-term depression
oaa04810  Regulation of actin cytoskeleton
oaa04910  Insulin signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing syndrome
oaa05034  Alcoholism
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100086380 (BRAF)
   04010 MAPK signaling pathway
    100086380 (BRAF)
   04012 ErbB signaling pathway
    100086380 (BRAF)
   04068 FoxO signaling pathway
    100086380 (BRAF)
   04024 cAMP signaling pathway
    100086380 (BRAF)
   04150 mTOR signaling pathway
    100086380 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100086380 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100086380 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100086380 (BRAF)
   04062 Chemokine signaling pathway
    100086380 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100086380 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100086380 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100086380 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100086380 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100086380 (BRAF)
   04720 Long-term potentiation
    100086380 (BRAF)
   04730 Long-term depression
    100086380 (BRAF)
   04722 Neurotrophin signaling pathway
    100086380 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100086380 (BRAF)
   05205 Proteoglycans in cancer
    100086380 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100086380 (BRAF)
   05212 Pancreatic cancer
    100086380 (BRAF)
   05225 Hepatocellular carcinoma
    100086380 (BRAF)
   05226 Gastric cancer
    100086380 (BRAF)
   05214 Glioma
    100086380 (BRAF)
   05216 Thyroid cancer
    100086380 (BRAF)
   05221 Acute myeloid leukemia
    100086380 (BRAF)
   05220 Chronic myeloid leukemia
    100086380 (BRAF)
   05218 Melanoma
    100086380 (BRAF)
   05211 Renal cell carcinoma
    100086380 (BRAF)
   05219 Bladder cancer
    100086380 (BRAF)
   05215 Prostate cancer
    100086380 (BRAF)
   05213 Endometrial cancer
    100086380 (BRAF)
   05224 Breast cancer
    100086380 (BRAF)
   05223 Non-small cell lung cancer
    100086380 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100086380 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100086380 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100086380 (BRAF)
   05160 Hepatitis C
    100086380 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100086380 (BRAF)
   01522 Endocrine resistance
    100086380 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100086380 (BRAF)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100086380 (BRAF)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100086380 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH FliD_N Kdo
Motif
Other DBs
NCBI-GeneID: 100086380
NCBI-ProteinID: XP_028929058
LinkDB All DBs
Position
10
AA seq 787 aa AA seqDB search
MEPEAAAAGAASSASSSSSAEPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYL
EAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSSSLSVAPSSLSVFQ
NPTDAARGNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYR
IQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGF
RCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLGETTLTSGSSPS
ATPSDSIGPPIVASPSPSKSIPIPQSFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNI
DDLIRDQGLRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFRGSTTGLS
ATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITV
GQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGY
STKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKS
NNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDV
YAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKK
KRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGG
YGGFPVH
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaggccgccgccgccggcgcggcctcctcggcgtcgtcctcctcatcggcc
gagcccgccatccccgaggaggtgtggaatatcaaacagatgattaaactgacccaggaa
cacatagaggccctgctggacaagttcggaggagagcacaacccaccatcgatctacctg
gaggcctacgaggagtacaccagcaagctggacgccctgcagcagagagagcagcagctg
ctggagtccctggggaacgggaccgacttctccgtttccagctccgcttcgacggacacc
gtcacgtcctcttcgtcgtccagcctctcggtggccccttcgtccctctcggtctttcag
aaccccaccgacgcggcccggggtaaccccaagtctccgcagaagccgatagtccgcgtc
ttcctcccgaacaagcagaggacggtggtgccggcaagatgtggggtgacggtccgggac
agcctaaagaaagccctgatgatgcgaggtctcatccccgagtgctgtgccgtttacaga
attcaggatggagagaagaagccgatcggctgggacacggacatctcttggctcacggga
gaagagttgcacgtggaagttttggagaacgttccgcttaccacccacaattttgtacgg
aagacattctttactttagcattctgcgacttttgtagaaagctgcttttccagggtttc
cgctgccaaacgtgtggctacaaatttcaccagcgctgtagtacggaggtgccgctgatg
tgtgttaattacgaccagcttgatttgctgtttgtctccaagttctttgaacaccaccca
ataccacaggaggaggcctccttaggagagaccacccttacgtcgggatcatccccttca
gccaccccctcagattctattggacctccaattgttgccagcccatcaccttcaaaatcc
attccaattccacagtccttccggccggcagatgaagaccatcggaatcagtttgggcaa
cgggaccgctcctcttcggccccaaacgttcacataaacacaatagagcctgtcaatatt
gacgacttgattagagaccaagggttacgtggggatggagcccctttgaaccagctgatg
cgctgccttcggaaataccaatcccggactcccagccccctcctccattctgtccccagt
gaaatagtgtttgattttgagcctggcccagtgttcagagggtcaactacaggcttgtct
gccacccctcctgcctccttgcccggatctctgaccaatgtaaaagcgttacagaaatct
ccaggacctcagcgggagaggaagtcttcgtcgtcctcagaagacaggaatagaatgaaa
accttaggtcgccgggactcgagtgacgactgggagattcccgacgggcagatcacagtt
ggacagaggatagggtcagggtcctttggaactgtctataagggaaaatggcacggtgat
gtggcagtgaaaatgttgaatgtgacagcccccacacctcagcagttacaggccttcaaa
aatgaagtaggagtgctcaggaaaacacgacatgtgaatatcctcctcttcatgggctat
tccacaaagccccagttggcgatcgtgacccagtggtgtgaaggctccagcttatatcac
catctccacatcatcgagaccaaatttgagatgatcaagctgatagacatcgcccggcag
actgcacaaggcatggactacttgcacgccaagtcaatcatccacagagacctcaagagt
aataatatatttcttcatgaagacctcacagtcaaaataggggatttcggtctagctaca
gtgaaatctcgatggagtgggtcccatcagttcgaacagttgtccggttccattttgtgg
atggccccggaggtaattagaatgcaagataaaaacccatatagctttcagtcggacgtg
tacgcgtttgggattgttctgtatgaactgatgacaggccagttgccgtactcgaacatc
aacaacagggaccagatcatttttatggtgggacggggctacctgtctccagacctcagt
aaagtgcggagtaattgtccaaaagccatgaagagattaatggcggagtgcctgaagaag
aaaagagacgagaggccactctttccacagattcttgcctccattgagctcctggcccgg
tcgttgccaaaaatccaccgcagtgcatctgagccctcgttgaaccgggccggcttccaa
acggaggattttagtctgtacgcgtgcgcctctcccaaaacgcccatccaggcaggggga
tacggtgggtttcccgttcactga

DBGET integrated database retrieval system