KEGG   Ornithorhynchus anatinus (platypus): 100086878Help
Entry
100086878         CDS       T01045                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa03030  DNA replication
oaa03410  Base excision repair
oaa03420  Nucleotide excision repair
oaa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100086878 (LIG1)
   03410 Base excision repair
    100086878 (LIG1)
   03420 Nucleotide excision repair
    100086878 (LIG1)
   03430 Mismatch repair
    100086878 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oaa03032]
    100086878 (LIG1)
   03400 DNA repair and recombination proteins [BR:oaa03400]
    100086878 (LIG1)
Enzymes [BR:oaa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100086878 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100086878 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100086878 (LIG1)
DNA replication proteins [BR:oaa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100086878 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100086878 (LIG1)
DNA repair and recombination proteins [BR:oaa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100086878 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100086878 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100086878 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C CbtA
Motif
Other DBs
NCBI-GeneID: 100086878
NCBI-ProteinID: XP_028929638
LinkDB All DBs
Position
10
AA seq 938 aa AA seqDB search
MQRTIMSFFQPMKGDRAKKEEKTPAEGSKVTEPPPKATLKEQSGVEPAGDSPVKRPGKKT
VRPLGSEGEEEDDDEIRAEEEPEAERPKAEAPPQASLRQEPASTSASTSAFPGEPSGPAA
SPVVLPSSSLVLSDSPGVSPSGSSQLSIPKRRTARKQLPKRKLGESPESEEAGVSPQGES
EAKKSKKEEERREPAEEGETAATSTVKAGSPEGKPDKVAGTGRTERDEKKQPKPRPSLSS
FFAPLKPAEKGAEKENALGKKPQEETVASSSPSPPDLPDPASYSPSKPNYHPTQDACWRH
GQRVPYLAVARTFEKIEEVSARLRIVETLSNLFRSVISLSPTDLLPCIYLCLNRLGPAHE
GLELGVGDTVLLKAIAQATGRQLDAVRAEAAERGDVGLVAESSRSTQRTVFAPAPLTVPG
VFAKLKEIAKMAGNASMNKKIEIIKGLFVACRHSEARFIARSLSGKLRIGLAEQSVLAAI
AQAATLTPPSQGYPPEVPDAGKGKSAEARKAWIEERVLIVKQTFCEVPNYDTIVPVLLEH
GVESLPDRCKLTPGVPLKPMLAHPTKGVGEVLKRFEEAAFTCEYKYDGQRAQIHILESGE
VRIYSRNQEDNTARYPDVIARVPKMKKASVTSCILDTEAVAWDRDRKQIQPFQVLTTRKR
KEVDAAEIKVQVCIYAFDIIYLNGEPLVRQPLSRRRQLLHEHFVETEGEFVFATALDSAD
TDQISEFLEQSVRDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIG
VYLGRGKRAGRYGGFLLAAYDDEGEEFQAVCKLGTGFSDEELDRHHRTLQDHVLPAPRPY
YRCDGTVAPDHWVEAAEVWEVKCADLSLSPIYPAAVGLVDSEKGISLRFPRFVRVRGDKK
PEEATTSAQVASLYQKQQQIQNQQGAAPASDPDPEDFY
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaacaatcatgtcgttcttccaacccatgaagggggacagggcgaagaaggag
gagaagacgccggcggaaggaagtaaagtgacggagcccccgccgaaggcgaccctgaag
gaacagagcggcgtggagcccgccggcgactcccccgtgaagcggcccggcaagaagacg
gtgcggcccctggggagcgagggcgaggaggaggacgacgacgagatccgggcggaggag
gagccggaagccgagcggcccaaggccgaggccccgccccaggccagcctccgacaggag
ccggcctcaacttcggcctcgacctcagccttccccggggaaccgtcgggtccagctgcc
tcgccggtggtgttgccgtccagcagtctggtcctgtccgactctcccggagtctcccct
tcaggcagctcccaattaagcatccccaaacgtcgcactgcccggaagcagttacccaaa
cgtaagctgggagagtcaccggaaagtgaagaagcgggcgtctccccccagggggagagt
gaagccaagaagagcaagaaagaggaagaacggcgagagcctgccgaggaaggggagacg
gcggcgacatcaacggtgaaagcggggagccccgaggggaagccggacaaggtggcgggg
acgggacgaacggagagggacgagaagaagcagcccaaaccgcgcccgtctctcagcagc
ttcttcgcccctttaaagccggcggagaagggggcggaaaaggagaacgctctggggaag
aagcctcaagaggagacagtagcgagcagctcccccagccccccggacctcccagatcca
gccagctacagcccctccaagcctaactatcatcccacacaggacgcctgctggcggcac
gggcagagggttccctacctcgctgtggcccggaccttcgagaaaatcgaagaagtgtcg
gccaggctccgcatcgtagagaccctcagcaacctgttccgctcggtcatctccctgtca
ccgacggacctgctcccctgcatctacctctgcctgaaccgtttgggcccggcccacgag
gggctggagcttggggtcggggacacggtcctgctcaaagccatcgcccaggccactggc
cgacagctggacgcggtgcgggcggaggcagcggaacggggggacgtggggctggtggcg
gagagcagccggagcacccagcgcaccgtgttcgcccccgcccccctcacggttcccgga
gtctttgccaagctcaaagagatcgccaagatggccggcaacgcgtccatgaacaagaag
atcgagatcatcaaaggcctgtttgtggcctgccggcattcggaggctcgcttcatcgcc
cggtctctgagcgggaagctgcgcatcggactggcggaacaatccgtcctggcggccatc
gcccaggctgccacgctcacccctccgagtcaagggtacccacccgaagtgccggacgcc
gggaaggggaagtcggctgaggcccgcaaggcgtggatcgaggagagggtcctgatcgtc
aagcagacgttctgcgaggtgccgaattacgacacgatcgtcccggtgctcctggagcac
ggcgtagagagcctgccggaccgctgcaagctgacgccaggcgtccccttgaagccgatg
ctggcgcaccccaccaagggggtcggggaagtgctgaaacgcttcgaggaggcggccttc
acttgcgagtacaaatacgacgggcaacgggctcagatccatatcctggagagtggcgaa
gtgcgaatctacagccgcaaccaggaggacaacaccgcccgctatcccgacgtcatcgcc
cgcgtccccaagatgaagaaggcgtccgtcacctcctgcatcttggacacggaagccgtg
gcctgggaccgggaccggaagcagatccagcccttccaggtcctcaccacacgcaagcgc
aaggaggtggacgcggccgagatcaaagtgcaggtctgcatctacgccttcgacatcatt
tacctcaacggggagccgctggtccgccagcccctctcccggcgccgccagctgctgcac
gagcacttcgtggagacggagggagagttcgtcttcgccaccgccctcgactcggccgac
acggaccagatctcggagttcctggagcagtctgtgcgagactcctgtgagggcctgatg
gtgaagacactggatgtggatgccacgtacgagatcgctaaacggtcccataactggctc
aagctgaagaaggactacctggaaggggtcggagacaccctggatctggtggtgatcggc
gtctacctcggccggggcaagcgggccggccgctacgggggcttcctcctggccgcctac
gacgacgagggggaggagttccaggccgtgtgcaagctggggacgggcttcagcgacgag
gagctggacagacatcaccggacgctccaggaccacgtgctccccgccccccggccctac
taccgctgtgacgggaccgtggcccccgaccactgggtggaggccgcagaggtctgggag
gtcaagtgcgccgacctgtccctctcgcccatctaccctgcagctgtgggcttggtggac
agcgagaagggcatctctttacgtttcccccggttcgtccgcgtccgcggcgacaagaag
ccggaagaggccacgaccagtgcccaggtggcctctctgtaccagaagcagcagcagatc
cagaaccagcagggagcggccccagcctccgaccccgaccccgaggacttttactga

DBGET integrated database retrieval system