KEGG   Ornithorhynchus anatinus (platypus): 100087932
Entry
100087932         CDS       T01045                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04062  Chemokine signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04217  Necroptosis
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04630  JAK-STAT signaling pathway
oaa04659  Th17 cell differentiation
oaa04917  Prolactin signaling pathway
oaa04920  Adipocytokine signaling pathway
oaa04931  Insulin resistance
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04935  Growth hormone synthesis, secretion and action
oaa05145  Toxoplasmosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05163  Human cytomegalovirus infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05212  Pancreatic cancer
oaa05221  Acute myeloid leukemia
oaa05223  Non-small cell lung cancer
oaa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oaa05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100087932 (STAT3)
   04066 HIF-1 signaling pathway
    100087932 (STAT3)
   04068 FoxO signaling pathway
    100087932 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100087932 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100087932 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100087932 (STAT3)
   04062 Chemokine signaling pathway
    100087932 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100087932 (STAT3)
   04917 Prolactin signaling pathway
    100087932 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100087932 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100087932 (STAT3)
   05206 MicroRNAs in cancer
    100087932 (STAT3)
   05205 Proteoglycans in cancer
    100087932 (STAT3)
   05203 Viral carcinogenesis
    100087932 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100087932 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100087932 (STAT3)
   05221 Acute myeloid leukemia
    100087932 (STAT3)
   05223 Non-small cell lung cancer
    100087932 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100087932 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100087932 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100087932 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100087932 (STAT3)
   05161 Hepatitis B
    100087932 (STAT3)
   05160 Hepatitis C
    100087932 (STAT3)
   05163 Human cytomegalovirus infection
    100087932 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100087932 (STAT3)
   05169 Epstein-Barr virus infection
    100087932 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100087932 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100087932 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100087932 (STAT3)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100087932 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C DUF4795 AP1AR Fib_alpha Syntaxin-6_N
Other DBs
NCBI-GeneID: 100087932
NCBI-ProteinID: XP_028931172
LinkDB
Position
11
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
AAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNSQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVAERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNSPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYILGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDLPKEEAFGKYCRPESQEHPEADTGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNSESVEPPAGGQFESLTFDMDLTSECAASPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctggacacccggtacctggagcaattgcaccag
ctgtacagcgacagcttccccatggaactgcgccagtttctcgccccgtggatcgagagc
caggactgggcttacgctgccagcaaggagtcccacgccacgctggtgttccacaatctc
ctgggtgagatcgaccagcagtacagtcgcttcctgcaggagtccaacgtgctctaccag
cacaacctgcgcaggatcaagcagtttctgcagagcaggtacctggagaagcccatggag
atagcacggatcgtggctcgctgcctgtgggaggagtcgcgcctgcttcagacggcggcg
gccgctgcccagcaaggggggcaggcaaatcaccccacggcggccgtggtcacagagaag
cagcagatgttagagcagcacctgcaggatgtgcgcaagagagtgcaggacttagagcag
aagatgaaggtggtggagaacctccaggacgactttgactttaactacaaaaccctgaag
agccaaggagacatgcaggacctgaatgggaacagccagtcggtgacgcggcagaagatg
cagcagctggagcagatgctcaccgccctggaccagatgcgccggggcatcgtgagtgag
ctggccgggctcctgtcggcgatggagtacgtgcagaagaccctcacggatgaggagttg
gctgactggaagcggcggcagcagatcgcctgcatcggcggccccccgaacatctgcctg
gatcgtcttgagaactggatcacgtccctggcagagtcgcagctgcagacgcgccagcag
atcaagaagctggaggagttgcagcagaaggtgtcgtacaagggcgaccccatcgtgcag
caccgccccatgctggaggagcgcatcgtcgagctcttccggaacctgatgaagagtgcc
ttcgtagccgagcggcagccgtgcatgcccatgcacccggaccggcccctggtcatcaaa
actggagtccagttcaccaccaaagtcaggttattggtcaaatttccggagctcaactac
cagctgaaaatcaaagtttgcatcgacaaagactccggggacgtggcggctcttcgagga
tcccggaagtttaacatcctggggaccaacacgaaggtgatgaacatggaggaatccaac
aacggcagcctgtccgccgagttcaagcacttgaccctgagggagcagaggtgcggcaac
gggggacgagccaactgcgatgcctctctgatcgtaaccgaagagctccacctcatcact
tttgagacggaggtgtaccaccagggcctcaagatcgacctggagacgcactccctgccg
gttgtggtcatctccaacatctgccagatgcccaatgcctgggcctccatcctgtggtac
aacatgctcaccaacagccccaagaacgtgaacttcttcaccaagccgcccatcggcacg
tgggatcaggtggccgaggtcctgagctggcagttttcgtccaccaccaagcgcgggctg
agcatcgagcagctgaccacactggctgagaagctcctggggcccggagtcaactattct
ggctgccagattacttgggccaaattctgcaaagaaaacatggctgggaaagggttctcc
ttctgggtgtggttggacaacatcatcgacctggtgaagaaatacatcctggcgctgtgg
aacgaggggtacatcctgggctttatcagcaaggagcgggaacgggccatcctgagcacc
aaacctcccggcaccttcctcctgcgcttcagcgagagcagcaaggaggggggcgtcacc
ttcacctgggtggagaaggacatcagcgggaagacacagatccagtcggtggaaccgtac
acgaagcagcagctgaacaacatgtcctttgccgagatcatcatgggctacaagatcatg
gatgccaccaacatcctggtgtcaccgctggtctacctgtaccccgacctccccaaagag
gaggcgttcggcaagtactgccggcccgagagtcaggaacaccccgaggccgacacaggt
gctgccccctacctgaagaccaagttcatctgtgtgaccccgacgacctgcagcaacacc
attgacctgccgatgtctccccggacgctggactccctgatgcagttcgggaacaacagt
gagagtgtcgagccccccgccggcggccagtttgagagcctgacctttgacatggacctg
acttcggagtgcgccgcgtcccccatgtga

DBGET integrated database retrieval system