KEGG   Ornithorhynchus anatinus (platypus): 100087993Help
Entry
100087993         CDS       T01045                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00512  Mucin type O-glycan biosynthesis
oaa00514  Other types of O-glycan biosynthesis
oaa01100  Metabolic pathways
Module
oaa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100087993 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    100087993 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oaa01003]
    100087993 (GALNT17)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100087993 (GALNT17)
Glycosyltransferases [BR:oaa01003]
 O-Glycan biosynthesis
  Mucin-type
   100087993 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100087993
NCBI-ProteinID: XP_028938644
LinkDB All DBs
Position
17
AA seq 598 aa AA seqDB search
MASLRRVKGLLALNLVAVAGFVLFLAKCRPGAVRTGDPLPEPQPRAQEDPRSPRGPGPVQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGRGGLPATLSPAEEERAKGPHEKYGY
NSFLSEKISLDRAIPDYRPTKCKELKYAKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKGPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAASGQ
VTGFFDAHVEFTAGWAEPVLSRIQENQRRVILPSIDNIRQDSFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEVGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERRKKPYNNNIGFYTKRNALRVAEVWMDDFKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKSFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPQDNHTAILYPCHGWGPQLARYTREGLLHLGALGTTTLLPDTRCLVDTGKTRSPQLLD
CDKVKSSLYKRWHFIQNGAVMNKGTGRCLEVESRGLSGLDLTLRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgttgcggagggtcaaggggctgctggcgttgaacctggtggccgtggccggc
ttcgtgctcttcctggccaagtgccggcccggggcggtgcggaccggcgaccccctcccc
gagccccagccccgggcccaggaggacccccgcagcccccgaggccccggccccgtccag
gacgcggtgctgaagcggctctccctgctggaggacatcgtctaccgacagctcaacggt
ttatccaagtccctaggcctcatcgagggctacggtgggcgcgggcggggaggtctgccc
gccacgctgtccccagccgaggaggagagagccaagggcccccacgagaagtatggctac
aactcgttcctcagtgagaagatttcgttggaccgtgccatcccggactatcggccaacc
aagtgcaaagagctgaaatatgccaaggacctgccgcagatctccatcatcttcatcttc
gtgaacgaggccctgtccgtgatcctgcgctccgtccacagcgccgtcaaccacacgccc
gcccacctgctcaaagagatcatcctggtggatgacaacagcgacgaggaggagctgaag
gggccactggaagaatacgtccacaagcgctatcccgggctggtcaaggtcgtacggaac
cagaagcgggaggggctgatccgcgctcggatcgagggctggaaagctgccagcggccaa
gtcaccggcttcttcgatgcccacgtggaattcactgcgggctgggcggagccggtgctg
tcccgcatccaggagaaccagaggcgggtgatcctgccctccatagacaacattcgacag
gacagcttcgaggtgcagcgctacgagaactcggcccacggctacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggatgccggagacccctctctgcccatc
aggactccggccatgatcggctgctccttcgtggtcaaccggaagttctttggagaagtg
ggtctcttggaccctgggatggatgtgtacggaggggagaacatcgaactgggcatcaag
gtgtggctgtgtggagggagcatggaggtgctgccgtgttcacgcgtggctcacattgag
cgccggaagaagccgtacaacaacaacattggcttctacaccaagaggaatgctctccgc
gtggccgaagtctggatggatgacttcaagtcccacgtgtacatcgcgtggaacttgccc
ctcgagaacccggggatcgacatcggcgacgtgtccgagcgcagagccctgcgcaagagc
ctcaaatgcaagagcttccagtggtatctggaccacgtgtaccctgagatgcgcagatac
aacaacaccgtggcctatggggagcttcgcaacaacaaggcgaaagatgtgtgtctggac
cagggccctcaggacaaccacacggccatcctctacccgtgccacggctgggggccgcag
ctcgcccgctacacccgggaggggctcctgcacctgggggccctgggcaccaccacactc
ctgcccgacacccgctgcctggtggacacgggaaagacccgctctccccagcttctcgac
tgcgacaaggtcaagagcagcctgtacaagcgctggcatttcatccagaacggagccgtc
atgaacaagggcacgggccgctgcctggaggtggagagccgggggctttctggcctggac
ctgaccctccgcagctgcaccggacagcgctggaccatcaaaaacttcatcaagtag

DBGET integrated database retrieval system