KEGG   Ornithorhynchus anatinus (platypus): 100088528Help
Entry
100088528         CDS       T01045                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00310  Lysine degradation
oaa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100088528
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100088528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oaa03036]
    100088528
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100088528
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100088528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HALZ
Motif
Other DBs
NCBI-GeneID: 100088528
NCBI-ProteinID: XP_007662267
LinkDB All DBs
Position
Un
AA seq 1227 aa AA seqDB search
SKALTYNDXIQAQKEISAHNQQLKEQTKQLEKENSELRNQSLQLLKARCEELKLDWSTLS
LENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELLQLKSYMPADETPSVHLRH
KSHLNRELEPEHSRFQLELECAKFSLPHINGMSPELSMNGHAAPYEIPSTLSRSSSKQNT
PQYLTSHLDQEIVPCTPNHNSRQKVDRVASLSIPDYTRFSPAKIALRRHLNQDHAATGKA
PASDLHQRAEHAKENGLSYQSPGISNGIKLSPQHVRPSSPSALQIAAGEKNTEKVLKERA
YASNGETITSLPISIPLSTVQPNKLPVSIPLSSVVLPSRVEKVRSTPSPVHQTRDSTSTL
EKQFGANSYNGLSSATGTKPFASATSGFSYSGSVAVGGTVSSSPAQLNHVVEQTALDDPS
NSGSLFNAVGSRSSTPQHPSLLMMQCRNSGPNSPAHQHPVSPRLPGAAQGLPGALQHADP
QKMFTEGHMGDLQSDWGFSDPESEAKRRIIFTISTNAGNLKQSPSNKHSPLTASIRTDCG
PAYMQDGKKRGRRKRSSSGHPSGLSPKRKPLPSVAGLFTPSSGSPLNINSMVNNINQPLE
ITAISSPENSLKNSPVPYQDNDQPPVLKKEKPLIQTNGIYYSPLTSDEEQGSEDERNSTR
IERKIATISLESKSPPKSMENAGGSGSSGRKPGPTHESTNSSKWKSTFSPISDLHLAKTA
DSPGQAAPPLFAFRPPSEDAGPADGKLSVHPRKNLAGGSAGAGALSPNGFAYNGGLSADL
SLHSFPDGASLSHKASEVTGLHSPLGFPSQRSRDVSVSETNPFLNKRQLDGLGGLKGDEF
GRAGGKSKEMSELGLHPSEKGPLQHSGKVGKGRDRDLEFKNGHNLFIAAAAAPPGGLLNG
RSLPTAGPSSGNSVSAVQTHHPFLNAVTAGSQFPLGPGTLPANLSSVASSSVLQSLFNSV
PTAASLVHVSSAATRLTNSHAMGSFSSGVTGGTVGGIFNHAVPSASSHQFGASFSSSAAC
GSVMLSSNPLQAVASTATSSFQAPSTSSSAAAAAAASSSSSSPSSSSSVTPGATRATQHL
NRPSGPPGLRALPPPPPNLLSLPPPPPLLASTSEPALLPSFPSVPANDTFIASSSSSSSS
SSSFSSSSSSSASAAAASVQSASASLSIKLASLPHKASHPSFTVHHQPLPRLAPVIAQSS
APGSSAMWVTLGTQSPYASHLSGVKPR
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
agtaaggcactgacttacaatgacntgattcaagctcagaaagagatctccgctcataac
cagcagttaaaggaacaaaccaaacagctagagaaagagaacagtgaactcaggaaccag
agcttacagctgcttaaggctcgatgcgaagagctgaagctggattggtccaccctgtcg
ctggagaatttactgaaggaaaagcaggccctgaagaatcaaatttcagaaaagcagaag
cattgtttggagttgcagatcagcatcgtggagctggagaagagtcaaaggcagcaggag
ctgttgcagctcaagtcctacatgccagctgatgagacaccgtcggttcatctgcgccac
aaaagccatttaaaccgggagctcgaacccgagcacagccgattccaacttgagcttgag
tgcgccaagttctctctgccccacatcaacggcatgagccccgaactgtccatgaatggc
catgcggctccctatgaaattcccagtacgttgagccggtcctcttccaagcagaacacc
cctcagtacctgacctcccacctggaccaagaaatcgtgccctgcactcctaaccacaac
agcaggcagaaggtggaccgagtggccagcttatccatccccgactacacccggttttct
ccagccaagatagccctacggagacacttgaatcaggatcatgcagccactgggaaagcc
ccagctagtgacctgcaccagagagctgagcatgccaaagagaatggcctttcatatcag
agccccgggatttcaaacggcataaaactgagtcctcagcacgttcggccttcttctcct
tctgctttacagattgcagcgggagagaagaacactgagaaggttttgaaagaaagagcc
tatgccagcaatggagaaacgatcaccagcttacccatcagtattcctctcagcacagtg
cagcccaataaactccctgttagtatcccactgtccagtgtagtcctgcccagccgggtt
gagaaggtgagaagcacacctagtccagttcatcagactcgagactctacttcaacactt
gaaaaacagtttggtgctaattcctataatggtctaagcagtgctactggaaccaagccc
tttgcttcggctacctcaggtttttcttattctggctcggtggcagtcgggggaactgtt
tccagcagcccggcccagcttaaccacgtcgttgagcagactgctctggatgacccgtcc
aattcggggagtctgttcaacgcagtaggctcccggagctccaccccacaacatccttct
ttgctcatgatgcagtgccggaattctggtccgaactcccccgcccaccagcacccggtg
agcccccggctccccggggccgcccaggggctgcctggggcgttgcagcatgcagatcct
cagaagatgttcactgagggccacatgggagacctgcagtctgattggggcttttctgat
cccgagagtgaagccaagagaagaattatctttaccatctctacaaatgcaggaaaccta
aaacagtctccttccaacaagcacagtcccctaacggcaagcatccgaacggactgtggg
ccagcctatatgcaggacggcaagaagagagggaggaggaagcggtcttccagcgggcac
cccagcgggctgtctcccaaacgcaaacccttaccgtccgtggcgggactctttactccg
tcgtcaggctcacccctcaacatcaactctatggtcaataacattaatcagcctttagag
atcacagccatttcctccccggaaaactccctgaagaattctcctgttccctaccaggac
aacgaccaaccgccggtgctgaaaaaggagaagccgctcatccagaccaatgggatttac
tattccccgctcacgtctgatgaagaacagggatccgaagatgagcgcaacagcaccaga
attgaaagaaaaattgccaccatctctttggaaagcaaatccccaccaaaatcaatggaa
aatgcagggggcagcggttcgtcaggaaggaaaccgggaccgacccacgagagcacgaat
agcagcaagtggaagtccaccttctcacccatctccgatctccacctggccaagacggcc
gacagccccgggcaggccgcaccacctctgttcgccttcaggccgccctcggaggacgct
gggcctgccgacggcaagctctcggtgcacccccggaaaaacttggccgggggctcggcg
ggggctggtgcgctcagcccgaatggatttgcctacaatgggggcctgtcagccgatctg
agtttacacagctttcctgatggtgcttctctctctcataaggctagcgaggtgacgggc
ttacattcccctctgggttttccatcccagcggagcagagacgtcagtgtctccgagaca
aacccctttctgaacaagcggcagctggatggcctggggggcttgaaaggggacgaattt
ggaagggcagggggcaaaagcaaagagatgagtgagttggggttgcatccatctgaaaaa
gggcccctgcagcacagtggcaaggttgggaaaggacgggaccgtgacctggagtttaaa
aatggccacaaccttttcatcgccgccgccgctgcccctcctgggggccttctcaatggc
agaagccttcccacggctggcccctcttctggcaactcagtatctgccgtgcaaacgcac
catcctttcttaaacgctgtcaccgctggatcccagttccccctgggccccgggaccctg
ccggccaacctcagttctgtggccagctcatcggtcttgcagtccttatttaattcagtg
cccacagctgccagtttggtccacgtgtcatcggctgcaaccagactgacaaattctcat
gctatgggaagcttctcttccggggtgacgggtggaacagttggaggtatttttaaccac
gcggtgccttctgcctcttctcatcagtttggagccagtttcagcagcagcgctgcctgt
ggcagcgtgatgctaagctcaaacccgctgcaggctgttgccagcacggccacctcttcc
tttcaggccccttctacttcttcttctgctgctgctgctgctgctgcttcatcttcttct
tcttctccttcttcttctagctccgtaacacctggtgccacccgagccacccagcaccta
aaccggccctctgggccacctggcctccgggccctgccacctcctcctcctaacctcctc
tcgttacctccccctccaccactgctcgcctctacctccgagcccgctcttctgcccagc
ttcccctcagttccagctaatgacacttttatagcctcctcgtcgtcgtcgtcctcctcc
tcctcctctttctcctcctcctcctcttcctccgcctctgccgccgctgcttctgtccag
tctgccagtgcatctttgtctatcaagctagcttctcttccgcacaaagcctcccatcct
tctttcacagtccaccaccagcctctgccccgcttggcacccgtgatcgcgcagtccagt
gccccgggctcctctgcgatgtgggttaccctgggcacgcagtctccctatgcttcgcat
ctttctggggttaagccacgataa

DBGET integrated database retrieval system