KEGG   Ornithorhynchus anatinus (platypus): 100090175Help
Entry
100090175         CDS       T01045                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04068  FoxO signaling pathway
oaa04146  Peroxisome
oaa04211  Longevity regulating pathway
oaa04213  Longevity regulating pathway - multiple species
oaa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100090175 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100090175 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100090175 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100090175 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100090175 (SOD2)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100090175 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100090175
NCBI-ProteinID: XP_001519389
LinkDB All DBs
Position
Un
AA seq 261 aa AA seqDB search
PKPQIRCDRSGPSVESSPGGTENGPREKIKSKWLFPPLFGFPRGLFRRSARLVPALGCLG
SRQKHTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEERYKEALAKGDVTTQ
VALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVG
VQGSGWGWLGFDQEQGRLRVAACSNQDPLQGTTGLVPLLGIDVWEHAYYLQYKNVRPDYL
KAIWNVISWENVTERYQACKK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ccgaagccgcagatccgttgcgatcgctccggtccctcggtagaaagctctcccggtgga
acggaaaacgggccaagggaaaaaatcaaatccaagtggctttttcctcctctttttggt
ttcccccggggtcttttcaggaggagcgctcggctggtgccggctttgggctgcttgggc
tccaggcagaagcacaccctccctgatctgccttatgactacggcgccctggaaccccac
atcaatgcccagatcatgcagctccaccacagcaaacatcacgccgcttacgtgaacaac
ctgaacgttacggaggagaggtacaaggaggcgctggccaagggtgatgttacaactcaa
gtggcgctccagcccgccctcaagttcaacggtgggggtcatatcaaccacaccattttc
tggaccaaccttagtcctaacggcggaggagaacccaaaggggagctgctggaagccatc
aagagggactttggctccttcgagaagttcaaggagaagctgacggcagtctcggtgggg
gtgcagggttcgggctggggatggctgggcttcgaccaggagcaaggacgcctccgggtt
gccgcttgttccaatcaggacccgctgcaaggaacgacaggtctggttcctctgcttgga
atcgatgtgtgggagcacgcttattatcttcagtataaaaatgttcggcccgattatctg
aaagctatctggaacgtgattagctgggagaacgtaaccgaaagatatcaagcttgcaaa
aagtga

DBGET integrated database retrieval system