KEGG   Ornithorhynchus anatinus (platypus): 100090228
Entry
100090228         CDS       T01045                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa04012  ErbB signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04110  Cell cycle
oaa04151  PI3K-Akt signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04934  Cushing syndrome
oaa05162  Measles
oaa05165  Human papillomavirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05202  Transcriptional misregulation in cancer
oaa05203  Viral carcinogenesis
oaa05206  MicroRNAs in cancer
oaa05215  Prostate cancer
oaa05220  Chronic myeloid leukemia
oaa05222  Small cell lung cancer
oaa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100090228 (CDKN1B)
   04066 HIF-1 signaling pathway
    100090228 (CDKN1B)
   04068 FoxO signaling pathway
    100090228 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100090228 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100090228 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100090228 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100090228 (CDKN1B)
   05206 MicroRNAs in cancer
    100090228 (CDKN1B)
   05203 Viral carcinogenesis
    100090228 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100090228 (CDKN1B)
   05220 Chronic myeloid leukemia
    100090228 (CDKN1B)
   05215 Prostate cancer
    100090228 (CDKN1B)
   05222 Small cell lung cancer
    100090228 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100090228 (CDKN1B)
   04934 Cushing syndrome
    100090228 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100090228 (CDKN1B)
   05169 Epstein-Barr virus infection
    100090228 (CDKN1B)
   05165 Human papillomavirus infection
    100090228 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100090228 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100090228
NCBI-ProteinID: XP_007656532
LinkDB
Position
11
AA seq 231 aa
MSDVRVSSGSPTLEPMEARQTERDHPKPSACRNLFGPVDHAELARDLRRHCRDLAEACRR
RWNFDFRNHRPLEGRYEWRPVDRDSLPDFYRRPPPPRRGPRRGPGDPRPTPDPPASRGGP
GRGPGRAPDSPDEEPEPGEEDRPRDRPQREEGDGDGDEEGAHLAGRKTDASERQTAFPDR
CPAPRKRPAPDDSSPPNKRAHPTEEGVPGGAPGTGPVEQTPEKPSLRRRQT
NT seq 696 nt   +upstreamnt  +downstreamnt
atgtcagacgtgcgcgtttccagcgggagcccgaccctggagcccatggaggcccggcag
accgagcgcgaccaccccaagccgtcggcctgcaggaacctcttcggccccgtcgaccac
gccgagctggcgcgggacctgcggcgccactgtcgcgacctggccgaggcctgtcggcga
cgctggaacttcgacttccgcaaccaccggcccctggagggcaggtacgagtggcggccg
gtcgacagggacagcctgcccgacttctaccgccggccgccgccgccccgtcgggggccc
cgtcgggggcccggggacccccgcccgacgccggacccgcccgcctcccggggaggcccc
ggacgaggccccggacgagccccggactccccggacgaggagccggagcccggcgaggag
gaccgcccccgggaccggccgcagcgggaagagggggacggcgacggcgacgaggagggc
gcccatttggcaggacgaaagactgatgcctccgaaaggcagacggccttccccgaccgc
tgtccggcgcctaggaaacgacccgccccggacgattcttctcctccaaacaagagagcc
caccccacggaagaaggggtaccagggggtgcgccgggcaccgggccggtggagcagacg
ccggagaagccaagcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system