KEGG   Ornithorhynchus anatinus (platypus): 100090413
Entry
100090413         CDS       T01045                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04010  MAPK signaling pathway
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04915  Estrogen signaling pathway
oaa05200  Pathways in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05223  Non-small cell lung cancer
oaa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100090413 (TGFA)
   04012 ErbB signaling pathway
    100090413 (TGFA)
   04014 Ras signaling pathway
    100090413 (TGFA)
   04151 PI3K-Akt signaling pathway
    100090413 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100090413 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100090413 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100090413 (TGFA)
   05212 Pancreatic cancer
    100090413 (TGFA)
   05225 Hepatocellular carcinoma
    100090413 (TGFA)
   05214 Glioma
    100090413 (TGFA)
   05211 Renal cell carcinoma
    100090413 (TGFA)
   05215 Prostate cancer
    100090413 (TGFA)
   05223 Non-small cell lung cancer
    100090413 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100090413 (TGFA)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 100090413
NCBI-ProteinID: XP_028922445
LinkDB
Position
5
AA seq 160 aa
MVPSAGELAWIGLGILLAACQALENTTSALSGAPVPAAVRSHFNECPDSHSQFCFHGTCR
FLVEENKPACKCHLGFMGERCEHADLLAVVAATQKKQTITALLVVSVLASVTLAAACVLI
HCCQIRRPLEWCRAVSCRQEKPSVLLKGRGASCCRSETAV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccttcggccggagagctggcatggatcggcctgggtattttattagctgcctgc
caggccctggagaacacgacgtcggccttgagtggcgctcccgtgcccgcggccgtccgc
tcccatttcaacgagtgcccggactctcacagtcagttctgcttccacggcacctgcagg
ttcttggtggaggagaacaagccggcgtgcaagtgccacttggggttcatgggagagcgg
tgtgagcacgcggacctgctggccgtggtggcggccacgcagaagaaacagaccatcacc
gccctgctcgtggtgtccgtcctggcttccgtcaccctggcggccgcctgtgtcctcata
cactgctgccagataagaagacccttggagtggtgccgggcagtgtcctgtcggcaggag
aagcccagcgtcctcctcaaggggcggggggcttcctgctgccgctccgagacagcggtc
tga

DBGET integrated database retrieval system