KEGG   Ornithorhynchus anatinus (platypus): 100092279Help
Entry
100092279         CDS       T01045                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00511  Other glycan degradation
oaa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100092279 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100092279 (NEU2)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100092279 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 100092279
NCBI-ProteinID: XP_001520932
LinkDB All DBs
Position
Un
AA seq 379 aa AA seqDB search
MASLPTLQKETLFQSGSRVYRIPALLYVARHQTLLAFAENRASSGDEDAKLIVMRRGAYN
ATTRQVQWQDAQVVAKAQLEAHRSMSPCPVYDEVTGTLFLFFNAIQGNVTERYQIDNKKN
LVRLCQVTSTDCGQTWSPASDLTDSAVGRTHRSWATFAVGPGHGLQLHDKARSLVIPAYA
YRILDLDERPPPSAFCFISHDHGKTWITGNFVKEENVLECQMAEVDSPSQKVLYCNARSP
RGSRVQAVSFNDGLDFQGARHVDKLVEPPSGCHGSVVGFPGPGQTLPRCSDTWMLYSHPT
DSTERKDLGVYLNRCPLDPAGWTKPAILAKGACAYSDLQYMGIGPDGSPQFGCLFEFGQR
DYYEEIVFLMFTLKQVFRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccttcctaccctgcagaaggagaccttgttccagtcaggatcccgggtgtac
aggattcctgccctactctacgtggcccggcatcaaactctcttggcatttgcagagaat
cgggcctcgtcgggagatgaagacgccaagctgatcgtcatgcgcaggggagcgtacaat
gcaaccacccggcaggtccagtggcaagatgctcaggtggtggccaaggctcaactggaa
gcccaccgctccatgagcccgtgtccagtgtatgacgaggtgaccgggaccctcttcctg
ttcttcaatgccatccaaggcaacgtcacggagcgctaccagatcgacaacaagaaaaac
ttggtgcgtctgtgccaggtgaccagcacggactgcgggcaaacctggagccccgcctcc
gacctcaccgactcggccgtcggccggacccatcgcagctgggccactttcgcggtgggc
ccgggccacggcctgcagctgcacgacaaggctcgcagcctcgtcatccccgcctacgct
taccggatactcgatctcgacgagcggcccccaccctccgccttttgcttcatcagtcac
gatcacgggaagacctggataactggcaactttgtgaaagaggagaatgtcctggagtgc
cagatggctgaagtggacagccctagccagaaggtcctgtactgcaacgccagaagtcct
cggggctctagggtccaggcggtgagtttcaacgacgggctagatttccagggcgctcgg
cacgtcgacaagctggtggaacctcccagcggctgccacgggagcgtcgttggcttcccg
ggccccgggcagacgttgccacgctgctcagacacttggatgctctactctcaccctacg
gactccaccgagaggaaggacctcggcgtgtatctcaacaggtgcccgctggatccagcg
ggctggacgaagcccgccattttggccaaaggggcctgcgcttactcggatctccagtac
atgggaattggcccagatggatcacctcagttcggttgcttgtttgaatttggccaacgc
gactactacgaggagattgttttcctcatgttcaccctgaaacaagtcttccgcgcctag

DBGET integrated database retrieval system