KEGG   Ornithorhynchus anatinus (platypus): 100093099Help
Entry
100093099         CDS       T01045                                 

Gene name
RNPEP
Definition
(RefSeq) LOW QUALITY PROTEIN: aminopeptidase B
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oaa01002]
    100093099 (RNPEP)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     100093099 (RNPEP)
Peptidases and inhibitors [BR:oaa01002]
 Metallo peptidases
  Family M1
   100093099 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 100093099
NCBI-ProteinID: XP_028925483
LinkDB All DBs
Position
7
AA seq 642 aa AA seqDB search
MLAAVVAVSGRQLQERALAQLSLDSAIFRSLTFNGRAIGISGSYLVKNLSMEQKLIPCIP
YLEKHPVFSERNNGGQDRALFSTPCLTASSLEDRGGGEKPQIREXNCAAESSXGYSXLVV
LPLPCXAGGAKVEDVTPKISFSSQVCWLSPEQTTGKKKPFVYTQSQAVLIRAFFRGFDTP
AVKSTHLSLCQVPDGFTAVMSATAWEKRGSSKFFLEMHQPIPSYLVALVIGDLVSAEVGH
GSQVXAEPCLIEAAREEYSGVIEEFVATGEKLFGPYCWGRYDLLFVPSFFPFGGMENPCL
TFVTPCLLAGDRSLTDIIIHEIAHSWFGNLVTSANWAEFWLNEXFTIYAQRRISTILFVA
AYTCLEAATGRALLRQHMDHTGEDHSLNKLRVKIEPGVDPEGTYNETPYEKGFCFVSYLA
HLVGDQSKFDDFLKAYVKEFKFQSILADDFLEYFLKYFPELKKKRVDSIPGFEFGRWLNT
PGWSPXVPDLSPGDSLMKPANDLAQPWAAPKLDLEAISTVDTSTWKTYQLVYFLNQILQK
SPLPAGELKKAYPKISDAKNAELRLRWGQIVLRNDYQEDFEKVKDSLHNQGKQKYTLPLY
RAMMSGSSAAQALAKATFAAIAPQLHFNVVNYVQQILESPKT
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcagtggtagccgtaagtgggaggcagctgcaagagagagccctggcccag
ctctccctggactcagcgatattccgatccctaacttttaacggtagggccatcggaatc
tcgggcagctacttggtgaaaaatctgagcatggaacaaaaactcatcccctgcattcct
tacctggagaagcatccagtgttttcagagagaaacaatggaggacaggaccgtgctcta
ttctctacgccatgtttaacagcctccagcctagaagatcggggcgggggagaaaagccg
cagatcagagagtgaaattgtgcagcagagagctcttgagggtattcgtaacttgtggtt
ctgcctttaccctgctgagccggtggagctaaggtggaagatgtcactcccaaaatcagt
ttctcctcacaggtgtgctggctgtctcctgaacagacaactgggaagaagaaacctttt
gtttatacccaaagtcaggctgtcctgatccgagcctttttccggggcttcgataccccc
gccgtaaaaagcacacacttatccctttgtcaggtgccagatggcttcacagcagtgatg
agcgccaccgcttgggagaaacgaggctcgagcaagttcttcttggagatgcatcagccc
attccctcctacttggtggctttggtaattggggaccttgtttcggctgaagtcggacac
gggagtcaggtgtaggcagagccatgtctgattgaggccgccagggaggaatacagtgga
gtgatagaagaatttgtggcaactggagagaagctttttggaccctattgctggggtagg
tacgacttgctgtttgtgccatcgttctttccctttgggggaatggagaacccctgcctg
acctttgtcactccctgtctgctggctggggaccgctccctgactgacatcatcatccac
gagattgctcatagctggtttgggaacctagtcaccagtgctaactgggctgagttttgg
ctcaacgagnatttcaccatttatgcccagagaagaatttccaccatcctgtttgttgct
gcttatacctgcctcgaagctgcaaccggaagggcccttctgaggcaacacatggaccac
actggggaagaccattctttaaacaagctgcgagtgaagatagagccaggtgtggatcct
gagggcacctacaatgaaacaccatatgagaaaggcttctgctttgtctcatacttggcc
catttggttggagaccagagcaaatttgatgattttttaaaggcctatgtgaaggaattt
aaattccagagcatcttggctgatgactttttggagtacttcttgaaatatttcccggaa
ctgaagaagaagagggtggactccattccaggctttgagtttggccgctggctaaacact
ccagggtggtccccctaggtccccgacctttctccgggagattcgctcatgaagccagcc
aatgacctggcccagccgtgggctgcccccaaactggatttggaggccatcagcaccgtg
gacacttccacctggaagacctaccagctggtctattttttgaatcaaatcctccagaaa
tctcctcttcctgcaggtgagctgaagaaggcctaccccaagatctcagatgccaagaat
gcagagttacgcctgcgctggggccagatagtcctcaggaatgactaccaggaggacttt
gagaaggtgaaggattccctacacaaccaggggaagcagaagtacacgctccctctctac
cgggccatgatgtcaggcagcagtgcagcccaagccctggccaaggcgacgtttgctgcc
atcgctccccagctccacttcaatgtggtcaactacgtccaacagatcctggagtcccca
aagacctag

DBGET integrated database retrieval system