KEGG   Ornithorhynchus anatinus (platypus): 100093611Help
Entry
100093611         CDS       T01045                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00052  Galactose metabolism
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
oaa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100093611
   00500 Starch and sucrose metabolism
    100093611
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100093611
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100093611
    3.2.1.20  alpha-glucosidase
     100093611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100093611
NCBI-ProteinID: XP_007663498
LinkDB All DBs
Position
Un
AA seq 1006 aa AA seqDB search
DQDPAAFGRDSLLANSSRHYLNIRYSLLPYLYTLFYRAHTEGGTVARPLMHEFYSDSETW
GISQQFLWGSGLLITPVLEQGAANITAYMPDAVWYDYETGVRSRWRKQEVVMHLPVDRLG
LHLRGGHILPTQKPATTTTTSRTKPLGLIISLDENNEARGELFWDDGTTNDTVASQAYLL
HEFSFIKVALITGLQLDLGKAYSLHWNLEFSDLERIDCLPDLEHPSEENCTVRGCVWEPT
NSSIPSCYTVSDAYSISNVQHEPMGLSADLTLTLPRSGLPSTPVHTLRLVVTYHKNNLLQ
FKIFDPNSQRYEVPVPLNTPHPPASTAEARLYDVIVKRNPFGIEIRRRSTSTVIWDSQLP
GFTFNDLFLRISTRLPSRHIYGFGETEHRTFRQDLDWHTWGMFSRDQPPGYKLNSYGVHP
YYMALEEDGHAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFFVVLGPTPELVTQQYTE
LIGRPVMPPYWALGFQLCRYGYQNDSEIAELYDEMVAAKIPYDVQYSDIDYMERQLDFTL
SPNFSGFPALIDRMKTAGMRVILILDPAISGNETKPYPAFTRGKQDDVFIRWPDGSDIAW
GKVWPDYPNVVVNGSLDWETQVELYRAHVAFPDFFRNSTAAWWKREILELHTNPREPHKS
LKFDGLWIDMNEPASFVNGAVGGCRNDVLNHPPYMPHLASRERGLSSKTLCMESQQFLTD
GSPVRHYDVHNLYGWSQMKPTYDAVQEATGQRALVISRSTFPSAGRWGGHWLGDNTAAWD
QLGKSIIGMMEFSLFGISYTGADICGFFNDADYEMCARWMQLGAFYPFSRNHNTIGTKRQ
DPVAWNKTFEDLSRSVLNTRYTLLPYLYTLMHDAHVNGSTVIRPLFHEFVEDTVSWDVFE
QFLLGPAFLVSPVLKANAVHVSAYFPKARWYSYHTGMEVGARGQWRNLSAPLDHINLHVR
GGHILPCQKPANNTHYSRRNALALLVALDEDGLATGQLFWDDGQSI
NT seq 3019 nt NT seq  +upstreamnt  +downstreamnt
gaccaggatccagccgcctttggacgcgactctctcctggccaactcctcaaggcactac
ctgaacatccgctacagtctgctgccgtacctctacaccctgttttaccgagcacacact
gaggggggcaccgtggccaggcccctgatgcacgagttctacagtgattcagaaacctgg
ggcatctctcagcagttcctgtggggttcaggactccttatcacaccagtcctggagcaa
ggggcagcgaacatcaccgcttacatgcccgacgccgtctggtatgactatgaaactggt
gtacggagccggtggcgaaagcaggaggtggtgatgcatcttccagtagacaggctgggg
cttcacctgcgagggggtcacatcctccccacccagaagccagccacaaccacgaccacc
agccgcacaaagcccctggggctcatcatctcactggacgagaacaacgaagccagagga
gagcttttctgggatgacggcacaactaacgacaccgtggcatcccaagcctatctgttg
catgagttttcattcatcaaggtggcccttatcactggcctccagctggacctgggaaaa
gcctattctctgcactggaacctggagttcagtgacttggaaaggatcgactgcttacct
gacctcgagcacccctctgaggagaactgtacagtccgtggttgtgtgtgggagcctacg
aactcatccatcccgtcttgctacaccgtcagtgatgcatattccatcagcaacgtccag
cacgagcctatgggactgtcagctgacctcacgctgaccctgcctcgctccggtctgcct
tcaacccctgtacacactctgcgcctggttgtgacctatcacaagaataacttgttgcag
tttaagatctttgatcccaacagccagaggtatgaagtgccagtgccactgaacaccccc
caccctccagccagcactgctgaagcccgactgtatgacgtcattgttaagcggaaccct
tttggcatcgagatcagacgcagaagcaccagcacggtgatctgggactcgcaactcccc
ggcttcacattcaatgacctgttcctgcgcatctccacccgcctgccctcccgccacatc
tacggcttcggggagacggagcaccggaccttccgccaggacctggactggcacacctgg
gggatgttctcaagggaccagcccccggggtacaagctgaactcatacggcgttcacccc
tactacatggctctggaggaggacggccatgcccacggtgtgctcctgctcaacagcaat
gccatggatgtcacgttccagccgacgccagcactgacctaccgcacgactggggggatt
ctggacttttttgtggtcttgggcccaactccagagctggtgactcagcagtacactgag
ttgattggacggccagtgatgccaccgtactgggctctgggcttccagctgtgtcgctat
ggataccagaatgactcagagatcgccgaactgtacgacgaaatggtggcagcaaagatt
ccctatgacgtgcagtactcggacatcgattacatggagcggcagttggatttcacgctc
agccccaacttttctggcttccctgccttgattgaccgcatgaagacagcagggatgaga
gtcatcctcatcctggatcccgccatctcgggcaatgagacgaagccatatccggcgttc
acccgggggaagcaggacgatgtcttcatccggtggccggatggcagcgacattgcctgg
ggaaaggtgtggccagattatcccaacgttgtggtaaacgggtcccttgactgggagacc
caagtggagctgtaccgggctcacgtggccttcccagactttttccgcaactcaacagct
gcctggtggaaaagagaaatcctggaactgcacaccaacccgcgggagccccacaagagc
ctcaagttcgatggcttgtggattgacatgaacgagccagccagctttgtcaatggtgcc
gtcggtggctgccgaaatgacgtcctgaaccaccctccatatatgccgcacttggcttcc
agggagcggggtctgagcagcaagaccctgtgcatggagagtcagcagttcctgactgac
ggctccccagtgcggcactatgatgtacacaacctgtacggttggtcccagatgaaaccc
acctatgacgccgtccaagaagctacagggcagcgggccctggtcatcagtcgctcgacg
ttcccctcagcagggcgctggggtggacactggctcggggacaacacagcagcatgggac
cagctggggaagtccatcatcggcatgatggagttcagcctcttcgggatttcctatacg
ggagcggacatctgtgggttcttcaatgacgcggactacgagatgtgtgcccgctggatg
cagctgggggccttctaccccttctcccgcaaccacaacaccatcggcaccaagagacaa
gacccagtggcctggaacaagacctttgaggatctctccaggagtgtgctcaacaccaga
tacaccctgctgccctacctatacacgctcatgcacgatgcccacgtgaacggcagcact
gtcatccgtccgctgttccacgagtttgtggaggacacggtgtcctgggacgtcttcgag
cagtttctgctgggccctgccttcctggtcagccctgttctcaaggccaatgcagtccac
gtctcggcttatttccccaaagctcgctggtacagctatcacacgggaatggaggtggga
gcgagggggcagtggaggaacctatcagcgcccctggaccacatcaacctgcatgtccga
ggaggccacatcctgccgtgccagaagccggccaacaacacccactacagtcgacgcaac
gccctggcactcctcgtggctttggatgaggacggactggccacagggcagcttttctgg
gatgatgggcaaagcatcg

DBGET integrated database retrieval system