KEGG   Ornithorhynchus anatinus (platypus): 103165526Help
Entry
103165526         CDS       T01045                                 

Gene name
CACNA1H
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H isoform X1
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04020  Calcium signaling pathway
oaa04713  Circadian entrainment
oaa04925  Aldosterone synthesis and secretion
oaa04927  Cortisol synthesis and secretion
oaa04929  GnRH secretion
oaa04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103165526 (CACNA1H)
   04020 Calcium signaling pathway
    103165526 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103165526 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    103165526 (CACNA1H)
   04927 Cortisol synthesis and secretion
    103165526 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103165526 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103165526 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oaa04040]
    103165526 (CACNA1H)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103165526 (CACNA1H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel FmiP_Thoc5
Motif
Other DBs
NCBI-GeneID: 103165526
NCBI-ProteinID: XP_028913077
LinkDB All DBs
Position
2
AA seq 2283 aa AA seqDB search
MSEGERREPFQPLTGDEQTTRPRSWCLGLVCNPWFEHVSMLAILLNCVTLGMFRPCEDVE
CRSQRCAILEAFDDFIFAFFAVEMVAKMIALGVFGQKCYLGDTWNRLDFFIVVAGMMEYS
LDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCCFVFFVFGVV
AVQLWAGLLRNRCFLDSDTARSHNLTFLKPYYQPEDGEENPYICSAHRDNGMQKCSGIPR
WKEQRLECNLSIGEAPGPQGTPPGTVSRHACVNWNQYYNVCRTGDVNPHNGAINFDNIGY
AWIAIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETK
QRENQLMREQRARSLSNDSTLASFSEPGSLYDELLKYLGHIFRKAERRAGRLYARWQSHC
RKVGPDGPGGRGRVGRGRGRTASPCPLARHHHHHHHHHHHHHHHHYHHYHLGNGSPGPEL
LRLDVEEDQTGGQLVLPVPAPRPWSPQPDSASARSIYHSNCHVMGLGDGGRQDPRPDPPS
GRNYPIILPSAATRPASGVSVPSVRGTPGSPVAGPQSPTQLDVDTCKKLRWPVREPGPGQ
TVNVPLSTLSTPRPLQRLQDGLPPCDSQSCPLCSRPLEDCEFEFSESGSCDSDPSGTYEF
TRDLRRRDHRDPVQRTGRLRGRTETPQRRNKAIRLWLAFGHRLERIVDSKYFNRGIMAAI
LVNTLSMGVEYHEQPDELTNALEISNSVFTSVFALEMLLKLLACGPIGYVKNPYNIFDGV
IVVISVCEIIGQADGGLSVLRTFRLLRVLKLLRFLPALRRQLVVLVKTMDNVATFCMLLM
LFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNG
MASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEENGHKTPARNLLHVPLLWLQGD
ANKSDTDEDKTSVNVEDDFDKISELWASVTQPGSWHHQPPDMKHFSLSVMGNGHLDGRGS
LPPPMILHTAATPGPTPQGSPQLDSGPALLGRQWADSASNNPLHCDQRSSASPRSSPCAS
RSPSGPTVSRRASWNSLGRPPSLKRRSHSGERQSLLAGEGRGSADDDADDTLPGARPPPI
RQAESLDCRLFSPPTPECPTPSPGPATDHHGTHSQALHGNGELFLHLDACRDQALDYDDD
VEDGFCFRVHQVLDRYKPGWCKSHEDWSLYLFSPQNRVRVMCHRFIAHKMFDHVVLAFIF
LNCITIALERPDIDPSSTERVFLSVSNYIFTAIFVVEMMVKVTALGFFSGDDAYLQSGWN
VLDGLLVFVSITDIVVSMAPAGGARILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLIS
SLRPIGNIVLICCAFFIVFGILGVQLFKGKFYYCEGSDTKNITTRGDCSLAHYRWVRRKY
NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPIQNHNPWMLLYFISFLLIVSFF
VLNMFVGVVVENFHKCREHQEAEEARRREEKRLRRLDKKRRKAQRRPYYADYSPLRLSIH
TLCTSHYLDLFITFIIGVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAVLKLVAF
GIRRFFKDRWNQLDLAIVLLSTLGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKM
ATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCSDDNPCEGLSRHATF
SNFGMAFLTLFRVSTGDNWNGIMKDTLRECPREDKHCLSYLPVISPIYFVTFVLIAQFVL
VNVVVAVLMKHLEESNKEAREDAEMDAEIELEMAQTGPGPVSRRPRGSPPGCRMSQPAPD
RAGLLQAGPDAQNLRVVRKIPVSRMHSLPNDSYMFRPLVPAQAPRPLPEEDPGPQDLDNE
LQASQVPTGSGTPAHSQPEGTGSSLALTPRTGSFHSKSGDLPGTQLRSPSLSRLLCRQEA
VRTDSVDGLPAECEEDPLGCPAEDKPLPSPPRASSPGSAEIPIHPHPSSPQGEPCDLADE
EVSHINSAARARGVPGPARSHSAYTSPGPGPRAPGPTSSTSAGSLAQGPGHDRDLRKFYS
VDAHGFLDQPGWAGDQRRHSIEICPARPETPSPSQPEADPAPPGGRRKKKMSPPCIAIDP
PGGSREGGPQRSLVTPGAAPMAAEASTMLRRRTPSWEPGAPRGPADQADAPPGDLLLLLP
PTRACRWERLAVPHSAFESPVPGTGDRSSEPWPGAPSDRSQETPPRSPHPETLPPDGGGA
RPA
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagggcgagaggagggagcccttccagccgctgaccggagacgagcagaccacc
cgcccccgcagctggtgcctcggactggtctgtaacccctggttcgagcacgtgagcatg
ctggccatcctgctgaattgtgtcaccctgggcatgttccggccatgcgaggacgtggag
tgccgttcccaacgctgtgccatcctggaggcgtttgacgacttcatctttgccttcttt
gctgtggagatggtggccaagatgatcgccctgggggtgttcgggcagaagtgttacctg
ggagacacgtggaaccgcctggatttcttcattgttgtagctgggatgatggaatattcc
ctggatggtcacaacgtcagcctgtcagctatccggaccgtccgagtgctcaggcccctc
agagccatcaaccgcgtgcccagcatgcggatcctggtgacactgctgctggacacactg
ccaatgctggggaatgtgctgctgctctgctgcttcgtcttcttcgtcttcggtgtcgtc
gcggtgcagctgtgggctggcctgctaagaaacaggtgcttcctcgacagcgacactgcc
aggagccacaacctgacatttctgaagccgtactaccagccagaggatggggaggagaac
ccgtacatctgctcggcccaccgggacaacggcatgcagaagtgctctggcattccccgc
tggaaggagcaacgcctggagtgcaacctgagtatcggggaggcccccggcccacagggc
acccctccaggcacagtctcccggcacgcctgtgtcaactggaaccagtattacaatgtc
tgcaggactggcgacgtcaacccccacaacggtgccatcaacttcgacaatatcggctat
gcctggattgccattttccaggtcataaccctggaaggatgggtggagatcatgtactac
gtcatggatgctcattctttttacaatttcatatatttcatcctgctaataatcgtgggc
tccttcttcatgatcaacctatgcctggtggtgattgccacgcagttctcagagacgaag
caaagggaaaaccagctgatgcgggagcagcgggcccgatccctgtccaacgacagcaca
ctggccagcttctccgaacccggcagcctctatgacgaattgctcaagtacctgggccac
attttccgcaaggccgagcgccgagcggggcgcctctatgcccgctggcagagccactgc
cggaaggtcggccccgacggaccagggggccggggccgggtgggccgggggcggggccgg
acggcctccccatgcccgcttgcccggcaccaccaccaccaccatcaccaccaccaccat
catcaccaccaccactaccaccactaccacctgggcaatgggagtccgggccccgagctc
ctgaggttggatgtggaggaggaccagacaggaggccagctcgtgctcccggtgccagcc
ccccggccttggagcccccagcctgactccgcttctgcacgtagcatctaccattccaac
tgtcatgtgatggggctcggggatggtgggaggcaggaccccaggcccgaccctccgagc
ggcaggaactacccaatcatcctgccttctgccgccaccagaccggccagtggtgtctcc
gtgcccagcgtcagggggaccccagggagccctgtggccggaccccaaagccccacccaa
ctggatgtggacacttgcaagaagctgcgttggcctgtcagggagcctggtccaggccag
actgtgaatgtcccgttgtccacactgagcactccccgtcccctgcagcgcctccaggat
ggcctgcctccctgtgactcccagagctgccctctctgctcccgccccctcgaggactgc
gagtttgaattcagtgagtcggggagctgcgactctgaccccagtggcacctacgagttc
acccgcgacctgaggcgccgggaccaccgggacccggtccagcggaccggccggttgcgg
ggccgaacggagacaccgcagaggaggaacaaggccatcaggctctggctggcctttggc
cacagactggagcggatcgtggatagcaagtacttcaacaggggcatcatggctgccatc
ttggtcaacaccctgagcatgggggtagagtaccatgagcagccagacgagctgaccaat
gccctggaaataagcaattcggtattcaccagcgtcttcgccctggagatgctgctgaag
ctgttggcgtgcggccccatcggctacgtcaagaacccgtacaacatcttcgatggggtc
atcgtggtcatcagcgtatgcgagatcatcgggcaggcggacggcggcctatcagtgctc
aggacgtttcggctgctgcgagtgctcaagctgctgcgcttcctgcccgccctgcgccgc
cagctggttgtgcttgtgaagaccatggacaacgtggccaccttctgcatgctactcatg
ctcttcatcttcatattcagcattctgggaatgcatctgtttggatgcaagttcagcctc
aagacagatacgggggacacggttccagaccggaaaaactttgattctttgctctgggcc
atagtcactgtgttccagatcctcacgcaggaagactggaatgtggtgctgtacaacggc
atggcatccacatcctcctgggctgccctctactttgtggcgctgatgacctttggcaac
tacgtgctcttcaacctgctcgtggccatcctggtcgaagggttccaggctgaggaaaat
ggacacaagaccccagccaggaatctactccatgtccccctactttggttgcagggcgat
gcaaacaagtctgacacagatgaggacaaaacatccgtcaatgtggaggacgattttgac
aaaatcagcgaactgtgggcctcagttactcaacctgggtcttggcatcatcagccccca
gacatgaaacatttctctctgtctgtgatgggtaacggtcacctggatggccggggcagc
ctgcccccaccgatgatcctgcacacggcagcaacccctgggccgacccctcaaggctca
ccacagctggactccgggcccgccctgcttgggcgccagtgggctgactccgcttccaat
aatcccctgcactgtgaccaaagatcctcggccagcccgcgcagctcaccctgtgcctct
agatctccctctggccccactgtcagccgtcgcgccagctggaacagcctgggccgcccg
cccagcctcaagcggaggagccactcgggcgagcgtcagtccctcctggccggcgagggc
aggggcagtgccgatgatgacgctgacgacaccctgcctggcgccaggccaccacccatc
cgccaagctgagtctctggactgccgccttttcagtccgcccacccccgagtgccccacc
cccagccctgggccagccactgaccaccatggcacccacagccaggcactgcatggaaat
ggtgagctctttctgcacctggatgcctgcagggaccaggccctcgactacgatgatgac
gtggaagacggcttctgcttcagggtgcatcaggttctggatcggtacaagcctggctgg
tgcaagagtcatgaagactggtccctgtacctgttttccccacagaaccgggtccgagtt
atgtgtcacagattcattgcccacaagatgttcgaccatgtggtcctggccttcatcttc
ctcaactgcatcaccattgccctggagcggccggacatcgaccccagcagcacagaacgg
gtcttcctgagtgtctccaattacattttcaccgccatttttgtggtggagatgatggtg
aaggtgacagccctgggcttcttctcgggggatgacgcctacctgcagagtggctggaac
gtgctggacggtctgctggtgttcgtgtccatcacggacatcgtcgtctccatggcgcca
gcaggcggggccaggatcctgggtgtcctgcgggtgctgaggcttctgcgtaccctgagg
cctctccgggtgatcagccgggctccaggcctgaagctggtggtggagacgctgatctca
tctctgaggcccatcggaaatatcgttctcatctgctgcgccttcttcatcgttttcggc
atcctgggggtgcagcttttcaagggaaaattctactactgtgagggctcggacacaaag
aacatcaccacgcggggagactgcagcctggcccactatcgctgggtccgcagaaagtat
aacttcgacaacctggggcaggcgctgatgtccctcttcgtcctgtcctctaaagacggc
tgggtaaacatcatgtacgatgggctggatgccgtgggcgttgatcagcagcccatccag
aaccacaacccgtggatgctcctgtacttcatctccttcctgctcatcgtcagctttttt
gtgctgaacatgttcgtgggcgtggtagtggagaacttccacaagtgccgggagcaccaa
gaggctgaggaggcgcgccggcgtgaggagaagcggctgcgacgtcttgacaagaagcgc
aggaaagcccagcgccggccatactacgcagattattcgccactccgcctctccatccat
acgctctgcaccagccactacctcgacctgttcatcaccttcatcattggagtcaacgtc
atcaccatgtctatggagcactataaccagcccaagtccctggatgaagcactgaaatat
tgcaattacgtcttcaccatcgtgttcgtcttcgaggcagtcctcaagttggtggcgttc
ggaatccggcgcttctttaaagacaggtggaaccagctggatctggctattgtgcttctg
tccaccctgggcatcacactggaggagattgagataaatgctgctctacccatcaacccc
accatcatccgcatcatgcgagtcctgaggatcgccagagtgctcaagctgctcaaaatg
gccacggggatgcgagccctgctggacactgtggtacaggcactgccccaggtggggaac
ctgggcctacttttcatgctcctgttttttatctatgctgcgctgggagtggagctgttt
ggaaagttagactgcagcgatgacaacccctgcgaggggctgagccggcatgccactttc
tccaactttggtatggcgttcctcaccctgttccgcgtctctactggagacaactggaac
ggaatcatgaaggatacgctacgggagtgcccacgggaggacaagcactgcctcagctac
ctgcccgtcatctcgcccatctacttcgtcacctttgtgctcattgcacagttcgtgttg
gtcaatgtggtggtggctgtgctcatgaagcacctggaggagagcaacaaggaggccagg
gaggatgccgagatggatgccgagattgagctggagatggcacagaccgggccaggacca
gttagccgccggccccgtgggagccccccaggctgcaggatgtcccagccagccccggat
agggctggtcttctgcaggcagggccggatgcccagaacctccgagtcgtccgcaagatt
cctgtctccaggatgcactctctgcccaatgatagctacatgttccgacctttggtgccg
gcccaggccccacgtccgctgcctgaggaggaccctgggccccaggacctggacaatgag
ctccaggcctctcaggtcccgacaggctctgggacaccagcgcactcacagcctgagggg
accggctcgtctctggccctcactccgagaacagggtccttccactccaaaagcggtgac
ctccctgggacccaacttcgctcccccagcctcagccgcctactatgccgacaggaggcc
gtgaggaccgactcggtggatggcttaccggctgaatgtgaagaggacccactgggatgc
cccgctgaggacaaaccactcccctccccgccaagggcctcttctcctgggtcggctgag
atccccatacacccgcacccctccagcccccaaggcgagccgtgcgacctggcggatgag
gaagtcagccacattaacagcgcggcgcgggcgcgcggggttccagggccagccaggagc
cactcggcctacacctccccaggccctggcccccgggctcccggccctacctccagcacc
agtgccggcagcctggcccagggccctgggcatgaccgggacttgcgcaagttctacagc
gtcgatgcgcatggcttcctggaccagcccggctgggccggcgaccagcggcgccactcc
atcgagatttgcccggcccgacctgagacccccagcccgtcccagcccgaggcagacccc
gcacctcctggtggccggcgcaaaaagaagatgagcccgccttgcatcgccatcgaccct
cccgggggcagccgggaaggcggtccccagcgctccctggtgacaccgggggcggcaccc
atggcggcagaggccagcactatgctgaggcggcggaccccgtcctgggagcctggtgcc
ccccggggcccagcggaccaggccgatgccccacccggggacctgctgctgctgctgccg
ccgacccgagcctgccgctgggagcgcctggccgtcccccactcggccttcgagtcaccc
gtccccggcacgggggaccgctcctccgaaccctggcccggggcaccctctgacaggagc
caggagactccgcccaggagtccccaccctgagacactgcccccagatggaggcggggcc
cggcctgcataa

DBGET integrated database retrieval system