KEGG   Ornithorhynchus anatinus (platypus): 114808091
Entry
114808091         CDS       T01045                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04060  Cytokine-cytokine receptor interaction
oaa04066  HIF-1 signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04630  JAK-STAT signaling pathway
oaa04640  Hematopoietic cell lineage
oaa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114808091 (EPO)
   04066 HIF-1 signaling pathway
    114808091 (EPO)
   04151 PI3K-Akt signaling pathway
    114808091 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114808091 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114808091 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114808091 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oaa04052]
    114808091 (EPO)
Cytokines and growth factors [BR:oaa04052]
 Cytokines
  CSF and other factors
   114808091 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 114808091
NCBI-ProteinID: XP_028911379
LinkDB
Position
X5
AA seq 196 aa
MGFHGTVCPVVLSPLLLLLLLPHLGVPARGSPLRPDCDSRVLERYIREAKEAENVTAGCA
EDCDLSENVTVPDTKVNFNTWKRMEVEEQAEEVRQGLSLLSEAVLRARTLLTNASRAPDL
PQQHLDKAVSGLRSLTALLRSLRGKGSSVTPTPTASPPPLRTLAVVSLAKLFRINSYFLQ
GKLKLFMGEACRKGDR
NT seq 591 nt   +upstreamnt  +downstreamnt
atggggttccacggaacggtgtgcccggtggtgttgtccccactgctgctgctcctgctc
ctgccgcacctgggggtcccggcccgggggtccccgctgcggcccgactgcgacagccgg
gtcctggagaggtacatccgggaggccaaggaggcggagaacgtcacggcaggctgcgcg
gaagattgcgacttgagcgagaacgtcactgtcccggacacgaaggtgaacttcaatacc
tggaagaggatggaggtggaagagcaggccgaggaggtgcggcaggggctgtccctgctg
tcggaagccgtcctccgggcccggaccctgctgaccaacgcctcccgggccccggacctc
ccgcagcagcacctggacaaagccgtcagtggcttgcgcagtctgaccgcactcctgagg
agcctgaggggcaaaggcagctcggtgaccccgacccccacggcgtccccgccgccactc
cgcaccctcgccgtcgtgtccctggccaagctcttccgcatcaactcctacttcctccag
gggaagctcaagctgttcatgggggaggcctgcaggaagggggacaggtga

DBGET integrated database retrieval system