KEGG   Ornithorhynchus anatinus (platypus): 114813305
Entry
114813305         CDS       T01045                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa01524  Platinum drug resistance
oaa04012  ErbB signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04110  Cell cycle
oaa04115  p53 signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04218  Cellular senescence
oaa04630  JAK-STAT signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing syndrome
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05163  Human cytomegalovirus infection
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05202  Transcriptional misregulation in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05211  Renal cell carcinoma
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05217  Basal cell carcinoma
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05222  Small cell lung cancer
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114813305 (CDKN1A)
   04630 JAK-STAT signaling pathway
    114813305 (CDKN1A)
   04066 HIF-1 signaling pathway
    114813305 (CDKN1A)
   04068 FoxO signaling pathway
    114813305 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    114813305 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114813305 (CDKN1A)
   04115 p53 signaling pathway
    114813305 (CDKN1A)
   04218 Cellular senescence
    114813305 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    114813305 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    114813305 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114813305 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    114813305 (CDKN1A)
   05206 MicroRNAs in cancer
    114813305 (CDKN1A)
   05205 Proteoglycans in cancer
    114813305 (CDKN1A)
   05203 Viral carcinogenesis
    114813305 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114813305 (CDKN1A)
   05212 Pancreatic cancer
    114813305 (CDKN1A)
   05225 Hepatocellular carcinoma
    114813305 (CDKN1A)
   05226 Gastric cancer
    114813305 (CDKN1A)
   05214 Glioma
    114813305 (CDKN1A)
   05216 Thyroid cancer
    114813305 (CDKN1A)
   05220 Chronic myeloid leukemia
    114813305 (CDKN1A)
   05217 Basal cell carcinoma
    114813305 (CDKN1A)
   05218 Melanoma
    114813305 (CDKN1A)
   05211 Renal cell carcinoma
    114813305 (CDKN1A)
   05219 Bladder cancer
    114813305 (CDKN1A)
   05215 Prostate cancer
    114813305 (CDKN1A)
   05213 Endometrial cancer
    114813305 (CDKN1A)
   05224 Breast cancer
    114813305 (CDKN1A)
   05222 Small cell lung cancer
    114813305 (CDKN1A)
   05223 Non-small cell lung cancer
    114813305 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114813305 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114813305 (CDKN1A)
   05161 Hepatitis B
    114813305 (CDKN1A)
   05160 Hepatitis C
    114813305 (CDKN1A)
   05163 Human cytomegalovirus infection
    114813305 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114813305 (CDKN1A)
   05169 Epstein-Barr virus infection
    114813305 (CDKN1A)
   05165 Human papillomavirus infection
    114813305 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114813305 (CDKN1A)
   01522 Endocrine resistance
    114813305 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114813305
NCBI-ProteinID: XP_028925557
LinkDB
Position
7
AA seq 177 aa
MDRDRDRDGRASASGVAGRSQPIACSGKLCRNLFGPVDAEQLRQEAQALLQSCADEAQRR
WNFDFITETPLEGDFAWERVRDLDLPALYLASPGWRGREGPAGKWQRARPASPALVQISS
RGDHVDLSLSCAVGPPPQRQDVGSPANSTPRGHKRRQTSMTDFYHSKRRLVLAKTKP
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaccgggatcgggatcgggacggccgagcctccgcgtccggcgtggcgggccggagc
cagccgatcgcctgcagcgggaagctgtgccggaacctgttcgggccggtggacgcggag
cagctgcgacaggaagcccaggccctcctgcagagctgcgccgatgaagcccagcgccgc
tggaacttcgactttatcaccgagacgcccctggagggagacttcgcgtgggagagggtg
cgggacctggacctgcccgccctctacctggcctcgccgggctggcgcggccgggagggc
ccggcggggaagtggcagagggcccggccggcctccccggctctggtgcagatctcctcc
cggggggaccacgtggacctgtcgctctcctgtgcggtggggccgcccccccagaggcag
gatgtggggtccccggccaacagcaccccccggggacacaagcggcgccagaccagcatg
acagatttctaccattccaagcgtcggttggtcctcgccaagacgaagccctga

DBGET integrated database retrieval system