KEGG   Ornithorhynchus anatinus (platypus): 114815476
Entry
114815476         CDS       T01045                                 

Definition
(RefSeq) uncharacterized protein LOC114815476
  KO
K05429  interleukin 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04060  Cytokine-cytokine receptor interaction
oaa04061  Viral protein interaction with cytokine and cytokine receptor
oaa04151  PI3K-Akt signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04630  JAK-STAT signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04672  Intestinal immune network for IgA production
oaa04940  Type I diabetes mellitus
oaa05135  Yersinia infection
oaa05142  Chagas disease
oaa05162  Measles
oaa05166  Human T-cell leukemia virus 1 infection
oaa05200  Pathways in cancer
oaa05320  Autoimmune thyroid disease
oaa05321  Inflammatory bowel disease
oaa05330  Allograft rejection
oaa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114815476
   04151 PI3K-Akt signaling pathway
    114815476
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114815476
   04061 Viral protein interaction with cytokine and cytokine receptor
    114815476
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114815476
   04660 T cell receptor signaling pathway
    114815476
   04658 Th1 and Th2 cell differentiation
    114815476
   04659 Th17 cell differentiation
    114815476
   04672 Intestinal immune network for IgA production
    114815476
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114815476
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114815476
   05321 Inflammatory bowel disease
    114815476
   05330 Allograft rejection
    114815476
   05332 Graft-versus-host disease
    114815476
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    114815476
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    114815476
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114815476
   05162 Measles
    114815476
  09174 Infectious disease: parasitic
   05142 Chagas disease
    114815476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oaa04052]
    114815476
   00536 Glycosaminoglycan binding proteins [BR:oaa00536]
    114815476
Cytokines and growth factors [BR:oaa04052]
 Cytokines
  Interleukins
   114815476
Glycosaminoglycan binding proteins [BR:oaa00536]
 Heparan sulfate / Haparin
  Cytokines
   114815476
SSDB
Motif
Pfam: IL2 IL15 Membralin FliG_N
Other DBs
NCBI-GeneID: 114815476
NCBI-ProteinID: XP_028932377
LinkDB
Position
12
AA seq 281 aa
MTVVIAELFAECIPLTLTKGHCCCYQRASYRPEIPCRKPYSNNHHTTSHSRHKTLSVTSQ
TLSEAPQASKYIYDHFVAFYIFNIHLPISPTFMREEKLFHAEHTSEMKSLSASQSVGFSN
QQGFHLHPFSAYEAFKKFQRVIRRGKKKYTDGAPTRQPLQPLQDDLVELQQIIKGLSEKD
RETVMNIPITLPKIDPQQKKAALGCFVNELKSSVNFLGGFTDFDQVILNKIKQLLQNIDK
TTTALLKNSTATNVTCPNDVEKNITEFLDAWITLCHRILNS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacagtggtcattgccgagttgtttgctgaatgcatccctcttactttaacaaaaggg
cactgctgctgttaccagagggcaagctaccggccagaaattccttgcaggaagccgtac
tccaataaccaccacaccaccagccactcacgccataagaccttaagtgtcacatctcag
accctaagtgaagctccacaagcatctaaatatatttacgatcattttgtcgccttttac
atttttaacatacatttgcccatctctcccactttcatgagggaggaaaaactgtttcat
gcagagcacacaagtgaaatgaagtctctctctgcctcacagagtgtgggcttctctaac
caacagggatttcacctacatccattcagtgcttacgaggctttcaagaaattccaaaga
gtcatcagaagaggaaaaaaaaagtacacagacggggcacccactcggcaaccgctacag
ccattacaggacgatctggtggaactccaacagattatcaagggactgtcagaaaaggat
cgagaaaccgtaatgaatattccaatcaccttacccaagattgaccctcagcaaaaaaag
gcagcccttggatgttttgttaatgaactgaaatcttcagtaaattttttaggaggcttc
accgactttgatcaagttattttaaacaagattaaacagttgcttcaaaatatcgataaa
actactactgctcttttgaagaactcgacggcaactaatgtgacctgcccaaatgatgtg
gagaagaatattactgaatttctggatgcctggattaccctctgtcacagaattttaaac
tcataa

DBGET integrated database retrieval system