KEGG   Ornithorhynchus anatinus (platypus): 114817987Help
Entry
114817987         CDS       T01045                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04146  Peroxisome
oaa04213  Longevity regulating pathway - multiple species
oaa05014  Amyotrophic lateral sclerosis (ALS)
oaa05016  Huntington disease
oaa05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114817987 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114817987 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    114817987 (SOD1)
   05016 Huntington disease
    114817987 (SOD1)
   05020 Prion diseases
    114817987 (SOD1)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     114817987 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 114817987
NCBI-ProteinID: XP_028938756
LinkDB All DBs
Position
17
AA seq 154 aa AA seqDB search
MALLKAVCVLKGDGPVHGIIKFEQKGDGPVTVSGKIEGLAEGEHGFHVHEFGDNTEGCTS
AGPHFNPESKRHGGPTDQERHVGDLGNVTADKGGVAPVSIQDSSISLSGPKSIVGRTMVV
HEKRDDLGRGGNEESTKTGNAGSRLACGVIGITR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgaaggccgtgtgcgtcctcaagggcgatggccccgtgcacgggatcatt
aagttcgagcagaagggtgacgggcccgtgacggtctcgggaaagatcgaaggactggcc
gagggagagcacgggttccacgtccacgagttcggagacaacacggaaggctgtaccagc
gccggcccccacttcaaccccgaatctaagagacacggtggcccgacagaccaggagagg
cacgtcggagacctgggcaacgtgacggccgacaagggaggcgtggcccccgtctccatc
caggactcgtccatctccctgtcgggaccaaagtccatcgtcggccgcacgatggtggtc
cacgagaagagggacgacctgggcagggggggaaacgaggagagcaccaaaacgggcaac
gcgggcagccgcctggcgtgtggcgtgatcggaattactcgctga

DBGET integrated database retrieval system