KEGG   Oscillatoria acuminata: Oscil6304_0035
Entry
Oscil6304_0035    CDS       T02368                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oac  Oscillatoria acuminata
Pathway
oac00010  Glycolysis / Gluconeogenesis
oac00020  Citrate cycle (TCA cycle)
oac00620  Pyruvate metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01200  Carbon metabolism
Module
oac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_0035
   00020 Citrate cycle (TCA cycle)
    Oscil6304_0035
   00620 Pyruvate metabolism
    Oscil6304_0035
Enzymes [BR:oac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Oscil6304_0035
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: AFY79795
UniProt: K9TBA6
LinkDB
Position
complement(45140..46408)
AA seq 422 aa
MINEVFMPALSSTMTEGKIVSWEKAPGDKVEKGETVVVVESDKADMDVESFYEGYLATIL
VQAGEAAPVGAAIALLAETEAEIEQAKQQGANLSNKSAQPAAAPQSTPSPAPEPAMATAG
APASRQNGRTVASPRAKKLAKEYKVDLATLSGSGPFGRIVAEDVEAAAGKAPAATATPAQ
PTVAAPPRIPTQAVPPAASGDVVPFNTLQNAVVRNMVASLQVPIFHVGYTITTDQLDKLY
KQIKSKGVTMTALLAKAVALTLQKHPLLNASCVDGGIQHHGNINIAVAVAMGDGGLITPV
LQNADQMDIYSLSRTWKDLVERARVKQLQPAEYNSGTFTLSNLGMYGVDSFDAILPPGQG
SILAIGGAKNQVVATDDGMMGVRRQMRVNITCDHRIIYGADAAAFLQDLAKLIETDAQSL
TM
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgattaacgaagtgttcatgcctgctctgagttccacgatgaccgaaggcaaaattgtc
tcttgggaaaaagcgccgggggacaaagtggagaagggcgaaacggtggtggtggtggag
tctgacaaagcagacatggacgtagagtccttctatgaaggttatctcgctacgatcctg
gtacaagctggagaagctgcccccgtaggcgcggcgatcgccttgttagctgaaacggaa
gccgaaatcgaacaggcgaagcagcaaggggcgaacctcagcaacaaatcggctcaaccg
gcagccgctccccagtctaccccatcccctgcaccggaaccggcaatggctacggctgga
gcccccgctagtcgtcaaaatggccgcacagttgcctctcctcgggccaaaaaattggcg
aaggaatacaaagtggatttggcaaccctctccggcagtggtccttttggtcggattgtg
gcggaagatgtagaagcagcagcaggtaaggccccagccgcgactgccaccccagcgcaa
ccgacggtagcagcacccccgagaattcccacccaggcagtcccccccgcagcctcggga
gatgtggtccccttcaataccctgcaaaatgcggtcgtccggaatatggtggcgtcatta
caggtgccgattttccatgttggctatacgattaccacggatcaattagacaaactctac
aaacagattaagtccaaaggggtgaccatgactgctctactggcaaaagcagtggccctc
acgttacagaaacatcctttactcaatgccagttgtgtggatggagggattcaacatcat
ggcaatatcaatattgctgtagcggtggcaatgggagatggcgggttaattacgccggtt
ctgcaaaatgccgaccaaatggatatttactccctatctcgcacttggaaggatttggtg
gaacgcgcccgagtcaaacagttgcaaccggcggagtataatagcgggacttttaccctg
tccaatttgggaatgtatggggttgatagttttgatgcgattctgcctccgggtcagggt
tcgattctcgccattggtggggcaaaaaatcaagtggttgccacggatgatggcatgatg
ggggtccggcgacaaatgcgggtgaatattacctgtgaccaccggattatctatggtgcc
gatgctgcggcattcttgcaagatttagcgaagttgattgaaactgatgctcagtctctc
acgatgtag

DBGET integrated database retrieval system