KEGG   Oscillatoria acuminata: Oscil6304_0953Help
Entry
Oscil6304_0953    CDS       T02368                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oac  Oscillatoria acuminata
Pathway
oac00630  Glyoxylate and dicarboxylate metabolism
oac00710  Carbon fixation in photosynthetic organisms
oac01100  Metabolic pathways
oac01120  Microbial metabolism in diverse environments
oac01200  Carbon metabolism
Module
oac_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oac_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oac_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Oscil6304_0953
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Oscil6304_0953
Enzymes [BR:oac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Oscil6304_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY80684
UniProt: K9TF82
LinkDB All DBs
Position
complement(1162890..1163225)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLSDAQIGKQIQYIIDQGYIPAIEFNETSDPTVYYWTMWKLPL
FNARSVQEVMSEVQGCRSEYPACYIRVVGFDNIKQCQVLSFIIHKPNTSRF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctgccaaaagagcgtcgttacgaaaccctttcctatctgccccctctgtct
gatgcacagattggcaagcagattcagtacatcattgaccaaggctacattcctgccatt
gagttcaacgaaacctctgaccccacggtttactactggaccatgtggaagctgcctttg
ttcaatgcacgttctgtccaagaagtgatgagcgaagtccaaggctgccgcagtgaatac
cccgcttgctacatccgcgttgtgggttttgacaacatcaagcagtgccaagtgctcagc
ttcatcatccacaaacccaacaccagccgcttctaa

DBGET integrated database retrieval system