KEGG   Oscillatoria acuminata: Oscil6304_1946Help
Entry
Oscil6304_1946    CDS       T02368                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
oac  Oscillatoria acuminata
Pathway
oac00500  Starch and sucrose metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oscil6304_1946
Enzymes [BR:oac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Oscil6304_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AFY81615
UniProt: K9TGD9
LinkDB All DBs
Position
complement(2359929..2362535)
Genome map
AA seq 868 aa AA seqDB search
MQPIRTFNVSPSLPERLEPLRTLAYNLHWDWNVETKDLFRRLDRDLWESSRHNPVLMLGT
ISQERLEEMAEDEGFIAQIDRAARQLDDYLKERTWYRKHREKEKHQECFVYFSAEFGLTE
CLPIYSGGLGLLAGDHLKSASDRGLPLVGVGLLYQEGYFSQYLNADGWQQERYPINDFYN
MPLHLERDAEGNELRIEVDYPGRKVYARVWRVQVGTVPLYMLDTNIEPNNPYDHDITDKL
YGGDLDMRIHQEMMLGIGGVRMLKALGYEPTAYHMNEGHSAFLALERISILIREQGLTFK
EAKEVVAASNVFTTHTPVAAGFDLFPHDKVMHYLGHYAEEFGLGREQFLALGRDNTGDLE
SPFSMATLAIEMASFINGVAKLHGEVSKVLFNNLWPELPPSEVPITSITNGVHARSCVAK
YTQELYDRYLGPKWSTTPPDYPLWERVDAIPDDELWRNQDLCRAELVVFVRERLQKYLRA
RGASFTEIDAAREVLDPGVITIGFARRFATYKRATLFLRDLDRIKRILLGLNTDLIPGGK
NALKKPMVQFVIAGKAHPHDIPGKEMIRHITHFIREQGCEKNVVFIPDYDINVARMMVSG
CDVWLNTPRRPREASGTSGMKASMNGLLNLSILDGWWDEADYVRTGWPIGHGEFYDDPNY
QDEVEANALYDLLEKEVIPLFYNRDEEGVPRKWVSKMKDAIRLNCPLFNTARMVSEYATR
AYFPASDRYYAMSANGCQPAKELAAWKTHLFESWYDIKILDIDISESDDVKVNQSINVKA
LLNLAGLTESDVEVQLYKGPMDADGNIINGVSVVMDYQGTDANQQSIYTANIAYSSSGLQ
GLSLRVLPKHPYLSSPFQPGLQVLWANA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattcgcacgtttaacgtttctccctctctgcctgagcgactcgaaccctta
cgcaccttggcttacaatctccactgggactggaatgtagagaccaaagacctattccgg
cgtttagaccgggacctgtgggaatccagccgtcacaatcccgtcttgatgctgggaacc
atttcccaggaacgcctggaagaaatggcagaagatgaaggctttatcgcccagattgac
cgtgcagcgcggcaactggacgactacctgaaagagcgcacctggtatcgcaaacaccga
gagaaagagaaacatcaagaatgttttgtgtatttctcggcggaatttggcctcacggaa
tgtctgccgatttactcggggggcttagggttactcgccggggatcacctgaaatctgcc
agcgatcgcggtttacccctagttggcgtcggactcctctaccaagaaggatattttagc
caatatctgaacgccgatggatggcagcaagagcgttaccccatcaacgacttctacaat
atgcccctgcacctagaacgagatgccgaggggaatgaattacggattgaggtagactat
cccgggcgaaaagtatatgcgcgggtctggcgggtccaagtggggactgttcccttgtat
atgctcgataccaacatcgaaccgaacaatccttacgaccacgatatcaccgacaaactc
tatggcggcgatctcgatatgcggattcaccaagagatgatgttgggaattggcggggtg
cggatgctcaaggccctcggctacgagcccaccgcctaccacatgaatgaagggcattcg
gcctttttagctttagaacggatttcaattttaatccgagaacagggtctcaccttcaag
gaagctaaagaagtggttgctgccagcaatgtcttcacgactcatactccggttgcggct
gggtttgacctgttcccccatgataaggtcatgcattatttgggtcattatgccgaggaa
tttggcctgggaagggaacaatttctagctttgggacgggacaatacgggggatttagag
tctccttttagtatggcaaccctggcgatcgagatggccagttttattaatggggtcgcc
aaattacatggcgaagtctccaaagtgctatttaataacctttggcccgaactccccccc
tcagaagtgccgattacctcgattaccaatggtgtacacgcccgcagttgcgtggcaaaa
tatacccaggaactctacgatcgctatctcggacccaaatggtccaccacccccccggac
taccccttgtgggaacgggtcgatgccatccccgatgatgaactctggcgcaaccaggac
ctctgccgtgcagaactcgtggtgttcgtccgggaacgactccaaaaatacttacgggct
cgtggcgcttcctttacggaaattgatgcagcgcgggaagtgctggaccccggagtgatc
accattgggtttgcacggcgctttgcgacctacaaacgggctacattattcctgcgcgac
ctcgatcgcatcaagcggatcttactcgggttaaataccgacctgattcccggggggaaa
aatgccctcaaaaagccaatggttcagtttgtcatcgccggaaaagctcacccccacgac
atccccggtaaagaaatgatccgtcatatcacccatttcattcgcgaacaaggatgcgaa
aaaaatgtggtgtttatccccgattacgatattaacgtagcgaggatgatggtgtcgggt
tgtgatgtgtggttaaataccccccgtcgtcctcgggaagcatcaggaaccagtgggatg
aaagcgtccatgaatggattattgaacctcagtatcctggatggatggtgggatgaagcg
gattacgttcgcaccgggtggccgatcggacatggggaattctatgatgaccctaactat
caagatgaagtggaagcgaatgctttgtatgacttgctggaaaaagaagtaattcccttg
ttctacaatcgcgatgaagagggtgttccccgcaagtgggtctcgaaaatgaaagatgcc
attcgcttgaattgtccgctgtttaatacggcgcggatggtcagtgaatatgcaactcgg
gcctatttcccggccagcgatcgctactatgccatgagcgcgaatgggtgccaaccggcg
aaagaattggctgcttggaaaactcacctgtttgaaagctggtatgacatcaagattttg
gacattgatatttctgaatcggatgatgtcaaagtcaaccaaagcattaacgtcaaagcg
ctgttaaatctagcgggattgaccgaatctgatgtagaagttcaactctacaaaggacca
atggatgctgatggaaatatcatcaatggtgtctctgtggtgatggattaccaaggcact
gatgccaatcagcaaagtatctatactgccaacattgcctacagttcctcgggattacaa
ggattgtctctgcgggtgttacccaaacatccctatttgagcagtcctttccaaccgggt
ctccaagtgctttgggctaatgcttag

DBGET integrated database retrieval system