KEGG   Oscillatoria acuminata: Oscil6304_2154Help
Entry
Oscil6304_2154    CDS       T02368                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oac  Oscillatoria acuminata
Pathway
oac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Oscil6304_2154
Enzymes [BR:oac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Oscil6304_2154
Transporters [BR:oac02000]
 Other Transporters
  Pores ion channels [TC:1]
   Oscil6304_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY81816
UniProt: K9TI58
LinkDB All DBs
Position
complement(2630837..2631496)
Genome map
AA seq 219 aa AA seqDB search
MLKLYYNLISLNSRRVWISLLEKGLPFELVPMKLDGDQFQGEFLALNPFHQVPVLEDEGF
VLVESLAILDYLEAKYPTPSLLPADPQMLGTVKMIELLTLTQMMPPMRPLMMNWMGFSQE
SLEKLQEAKQNLAQVLGFFESKLADRPYFGDQQLTLADIVAGTAIPFLPSMGLPLDDYPQ
LKDWCDRLMTRESWQQTQPTEKEITEFKTQMKILLSQRP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctatactacaatctcatttctttgaactctcgccgggtctggatctcctta
ttagagaaagggctaccatttgaattggtcccgatgaaactcgatggcgatcagtttcaa
ggggagtttttggcactcaatccgtttcaccaagttccggttttggaagatgagggattt
gtgctcgtggagtctttggcaattttggattacttagaggcaaaatatccgactccttct
ttactgcctgcggatccgcagatgttaggaacggtgaaaatgattgagcttttgacttta
actcagatgatgcccccgatgcggcccttgatgatgaattggatggggttttcgcaagaa
agtctggaaaagttgcaggaagcgaaacagaatcttgcccaggtgttaggcttttttgaa
agtaagttagccgatcgcccctattttggagaccaacagctcaccttggccgatattgtt
gccggaactgcgattccatttttgccgagtatgggattacccctggacgattatcctcag
ttaaaagattggtgcgatcgcctgatgacccgcgagagttggcagcaaacccaacccact
gagaaagaaattacagaatttaagacccaaatgaaaatcttgctctctcagcgcccgtaa

DBGET integrated database retrieval system