KEGG   Oscillatoria acuminata: Oscil6304_2434Help
Entry
Oscil6304_2434    CDS       T02368                                 

Definition
(GenBank) glycosyl hydrolase, glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
oac  Oscillatoria acuminata
Pathway
oac00500  Starch and sucrose metabolism
oac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oscil6304_2434
Enzymes [BR:oac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Oscil6304_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AFY82057
UniProt: K9TGQ5
LinkDB All DBs
Position
2998421..3000823
Genome map
AA seq 800 aa AA seqDB search
MTTIYNNKPAFGKPGLKPHWTMGNKDGVGTAHALSTRLWFSLSQGVVTEVYYPTIDSPQI
RELQYAIGDGKTFILQEKDHIQAKIERLAPHVLGYQLTNADPEGRYQIHKEIITDATFPC
LLQQTKITGDRGAIEQLKLYVFCSPHLGSSGWENDAAIVEAAGWKILTAKKDGVWLAMVA
TVPFTRLSCGYIGESDGWTDLEQNYQMDWEFDSAEAGNVALTGEIALKGVEEFILGVAFG
DCCHDAITTLLLALDIPYSEHRERYIEQWNQINETAIPLESGSGDGGSLYDSSFSLLLAH
EDKTYPGATIASLSIPWGQAKSYDEQGAYHLVWPRDMVNTVTGLLAAGHFSTALEALIYL
SVSQCTDGGFAQNFWLNGDPHWTGSQLDQVSFPITLAWRMHQHKALRNFDPYPMVLKAAR
YMIDRGPATEQERWEENYGYSPSTLASNIAALICAGALARENGDDAIAEFLEEYADFLEA
HLEPWTVTNQGTLVPEIPRHYIRINPVKGDDPHGDEDLHGKLVAIANRPSDKPSKFPASE
IVDAGFLELVRYGIRSPDDPLIVNSLKVVDAMLKVDTPYGPCWHRYNHDGFGQREDGGPF
KSEGKGRAWPILTGERGHYELAAGRDVKPYLQAMEGFASSTGLLPEQIWDEEDRPELGLY
LGKTTGAAMPLAWAHSEYIKLLRSLRDGQVFDFIPEVADRYLHGGKPQHPQMEMWKFNRQ
ISKVKAGSTLRILAITPFQLHWSPDGGEMQNQSDSQSSGIGIEFVDLAIQPEEATRINFT
FFWPECDKWEDKTYQVEVMN
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgactaccatttacaataacaaacctgcttttggaaaaccggggcttaaaccccattgg
actatgggaaataaagacggagtgggaacagctcatgctctgtctacgagactctggttt
agcttatcccagggggtggtcaccgaggtgtattatcccaccattgattcgcctcaaatc
cgagaattgcagtatgcgatcggggatgggaaaaccttcattcttcaggaaaaagaccac
atccaggctaaaatcgaacgtcttgcgcctcatgttctgggatatcaactgaccaatgct
gacccagaaggacggtatcaaattcataaagaaatcatcaccgacgccacatttccctgt
ctgttgcagcagacgaaaatcaccggggaccggggggcgatcgagcaattgaaactctat
gttttctgttcacctcatttgggaagttcagggtgggaaaatgatgcggcgatcgtggaa
gcggcaggatggaaaattctcacagccaaaaaagatggagtatggttagcgatggtcgca
accgtgccctttacccgtctctcctgcggttatattggggaaagcgatggctggaccgac
cttgagcaaaattatcagatggactgggaatttgattccgctgaggcggggaatgttgct
ctgacgggagaaatagcactcaagggagtggaggagtttatcctgggagtggcttttggc
gattgctgtcatgatgccatcaccaccctgttactggctctggatatcccctattcggaa
catcgtgagcgatacattgaacaatggaatcaaatcaacgaaacggccatccctctggaa
agtggaagtggggatggggggagcttgtatgacagcagctttagtctattactcgctcac
gaagataaaacctacccgggggcgacgatcgcctctctgtcgattccctggggacaagct
aaaagctatgatgaacagggagcctatcatctcgtttggccccgagatatggtcaacacc
gtgaccgggttactcgctgctggacatttcagtaccgccttagaagccttaatttattta
tctgtctctcaatgtactgatggggggtttgctcaaaacttctggttaaacggcgatccc
cactggacgggaagtcaactggatcaggtgtcttttcccatcaccttggcatggcggatg
caccaacacaaagccctgcggaacttcgacccctatccgatggtactcaaggcggcacga
tatatgatcgatcgcggtccagccacagaacaggagcgttgggaagaaaattatggctat
tctccctccactttagcctcgaatatcgccgcgctgatttgtgccggggctttagcgcgg
gaaaatggggacgatgcgatcgccgagtttttagaggagtatgcggactttttggaagcg
catttggaaccctggacagtgaccaatcaggggactttagtgccagagattccccggcat
tatattcggattaatccggtgaagggggatgaccctcatggggatgaggatttgcacgga
aaattggtggcgatcgccaatcgaccctcggataaaccatcgaagtttcccgcgagtgaa
attgttgatgccgggtttttggaactggtccgctacggcatccgcagtcccgatgacccc
ttgattgttaactccctcaaggtggttgatgcaatgctcaaagtcgatacgccttatggt
ccctgttggcatcggtataatcacgatgggtttggacaacgagaagatggcggccctttc
aaaagtgagggcaaaggacgagcatggcccatcctgacaggagaacgaggtcattatgaa
ttagctgccggacgggatgtaaagccctatcttcaagcaatggaagggtttgcttcctct
accggattgttaccggagcaaatttgggacgaagaggaccgcccggaattggggttatac
ttaggcaaaaccactggtgcagcgatgccgttagcttgggcacattcggagtatattaaa
ctgttgcgatcgctgcgggatggccaagtctttgattttattcccgaagtggccgatcgc
tatcttcacggggggaaacctcagcatccccagatggaaatgtggaagttcaaccggcag
atttctaaggttaaagccggttcaaccctacgaattctggcaattaccccgttccaattg
cattggtccccggatggtggagaaatgcagaaccaaagtgattctcaatcctcgggaatt
ggcattgagtttgtcgatttggcgattcaaccggaagaagcgacccgaattaactttacc
tttttctggccggaatgcgataaatgggaagacaaaacctatcaggttgaggtgatgaat
tag

DBGET integrated database retrieval system