KEGG   Oscillatoria acuminata: Oscil6304_4734Help
Entry
Oscil6304_4734    CDS       T02368                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
oac  Oscillatoria acuminata
Pathway
oac00061  Fatty acid biosynthesis
oac00780  Biotin metabolism
oac01100  Metabolic pathways
oac01130  Biosynthesis of antibiotics
oac01212  Fatty acid metabolism
Module
oac_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Oscil6304_4734
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Oscil6304_4734
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Oscil6304_4734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oac01004]
    Oscil6304_4734
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Oscil6304_4734
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Oscil6304_4734
Lipid biosynthesis proteins [BR:oac01004]
 Fatty acid synthase
  Component type
   Oscil6304_4734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1598
Motif
Other DBs
NCBI-ProteinID: AFY84245
UniProt: K9TNX5
LinkDB All DBs
Position
complement(6044459..6045235)
Genome map
AA seq 258 aa AA seqDB search
MLDLTGKNALVTGIANNRSIAWGIAQQLHKAGANLGITYLPDEKGRQEKKVKELVEPLNP
SLFVPCNVQDDAQIQATFDTIRETWDKIDILIHCLAFAGKDELTGDFSNTSREGFTRALD
ISSYSLVSLAAAAKPLMTQGGSIVTLTYLGGVRVIPNYNVMGIAKAALEMNVRYLAAEMG
PQNVRVNGISAGPIRTLASSAVGGILDMIHHVEEMAPLRRTVTQTEVGNTAAFLCSDLSS
GITGQIIYVDSGYCIMGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctagatttaacaggaaaaaacgccttagtcaccggaattgctaacaaccgttccatc
gcttggggtattgcccaacaactccacaaagctggggccaatctcggcatcacctatctc
ccggatgaaaagggccgtcaagaaaaaaaagtcaaagaattagtcgaacccctcaacccc
agtttgttcgttccctgcaacgttcaagatgacgcccaaattcaagccaccttcgacacc
atccgcgaaacttgggacaaaatcgacatcctgatccactgtctcgcctttgccggtaaa
gatgaactcaccggagactttagcaacacctcccgcgaaggctttacccgcgctttggat
attagttcctactccctggtttccctcgctgctgccgccaaacccctaatgacccaaggc
ggcagcatcgtcaccctcacctacctcggtggcgttcgcgtcatccccaactacaacgtc
atggggattgccaaagctgccttagaaatgaatgtccgctacctcgccgctgaaatgggc
ccccaaaatgtccgcgtcaatggcatctctgccggtcccatccggaccctcgcctcttct
gccgtcggtggcatcctggacatgatccatcatgtggaagaaatggcccctctgcgccgg
accgtcacccaaaccgaagtcggcaatactgcggcattcctctgtagcgacttatctagc
ggcatcacgggtcaaatcatctatgtcgattctggctactgcattatgggaatgtaa

DBGET integrated database retrieval system