KEGG   Oscillatoria acuminata: Oscil6304_5741Help
Entry
Oscil6304_5741    CDS       T02368                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oac  Oscillatoria acuminata
Pathway
oac00010  Glycolysis / Gluconeogenesis
oac00030  Pentose phosphate pathway
oac00051  Fructose and mannose metabolism
oac00052  Galactose metabolism
oac00680  Methane metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
oac01230  Biosynthesis of amino acids
oac03018  RNA degradation
Module
oac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_5741
   00030 Pentose phosphate pathway
    Oscil6304_5741
   00051 Fructose and mannose metabolism
    Oscil6304_5741
   00052 Galactose metabolism
    Oscil6304_5741
  09102 Energy metabolism
   00680 Methane metabolism
    Oscil6304_5741
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Oscil6304_5741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oac01009]
    Oscil6304_5741
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oac03019]
    Oscil6304_5741
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Oscil6304_5741
Protein phosphatases and associated proteins [BR:oac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Oscil6304_5741
Messenger RNA biogenesis [BR:oac03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Oscil6304_5741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFY85216
UniProt: K9TSR1
LinkDB All DBs
Position
complement(7369766..7372045)
Genome map
AA seq 759 aa AA seqDB search
MHQRKRLGVLTSGGDSPGMNAAVRSVVRSAIAQGIDVFAIYEGYQGMVEGGQCDLKNPRR
VAPDAEACIRQLHWYDVAGILHKGGTIIGTARSAQFRTREGRLQAVRNLLAHDIDGLVAI
GGDGSLTGAHLFRSEWPELVAELLEGGEIDAEVAERHRHLTIVGLAASIDNDMYGSDMTI
GTDTALHRLTEAVDSISSTAASHQRTFVVEVMGRHCGYLALMGALATGADWVLIPECPPE
GDCWEEKMCQVLQAGRESGRRDTIVIVAEGAKDRHGNPISCEYVRQVLEEQLGEDARVTI
LGHVQRGGSPTAFDRNLSTLLGHAAVNAFQTATPESESVLIGMRGNRVYQAPLMHCVEQT
HAVSQAIADGDYDKAMNLRGENFKNAYQILHTLMQAKPSNPEPREGKPLRFAILNCGATA
PGMNTAVRAAVRLAIDKGHTMLGVEHGFRGLIEGHIKELNWLSVRGWATTGGSELGTSRK
IPQGKDFYAIARQIERHDINGLLIIGGWSGYQAAYQLYSQCETFPAFNIPILCIPASINN
NLPGCELSIGADTALNNIIEAVDKIKQSAVASNRCFLVKVMGRYCGYLAVMSGLATGAER
VYINEEGVALTDLQKDLSTLISGFKQGKRVGLIICNENAHPVYDSDFICDLFAEEGKEVF
QVREAILGHLQQGGDPTPFDRIQATRFSAIGLDFLIEQAKRPSPTGAFMGTEAGNVRFVD
LGMIPRMVDKEHQRPKEQWWMETAAIGKILAHYAPPIEG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagagaaaaagactaggcgtattaaccagtgggggagactcgccgggaatgaat
gctgcggttcggtccgtggtccggtctgcgatcgcccagggaattgatgtatttgccatt
tatgaaggttatcaggggatggtggaggggggacaatgcgacctgaaaaacccccgccgg
gttgcccctgatgccgaggcttgtattcgccaactccattggtatgacgtggcggggatc
ttacataagggggggacaatcatcggaacggcgcgatcggcccagtttcggacccgggaa
ggtcggttgcaggcggttcggaatctgttagctcatgatattgatggattagtggcgatc
gggggggatggcagtctcaccggcgctcacttgttccgcagtgaatggccggaattggtc
gctgaactcctggaaggcggtgaaattgatgccgaagttgcggaacgtcaccgccactta
accattgtcggattagcggcatctattgataatgatatgtatggcagtgatatgaccatc
gggactgatactgccctccaccgcttaacggaagctgtagactcgatttcttctaccgct
gccagtcatcagcgcacttttgtggtggaagtgatgggacggcattgcggctatctggcg
ttaatgggggcattagctacaggtgcagactgggtattgattcccgaatgtcctcccgaa
ggggattgctgggaagagaaaatgtgccaagtgctccaagccggtcgagaatccgggcgt
cgtgatacgattgtgattgtcgccgaaggtgctaaggaccgtcacggtaacccgatttct
tgtgaatatgtgcgccaagtgctagaagaacaactcggtgaagatgcccgtgtcacgatt
ttaggccatgtgcaacgaggcgggtcacccacagcttttgaccgcaatttaagcacgttg
ttaggtcatgcggcagtgaatgcttttcaaacggccacccccgagagtgaatctgttctg
attggaatgcgggggaaccgggtttatcaagcccctttgatgcattgtgtggaacaaacc
catgcagtttctcaggcgatcgccgatggagattacgacaaggcgatgaatctgcgggga
gagaacttcaaaaatgcctatcaaatcttgcatactctgatgcaagccaaacccagtaat
ccggaaccccgggaaggcaaacccttgagattcgccatcctcaactgtggtgcaaccgcc
ccgggaatgaatacggcggttcgcgcagcagtccgactggcgatcgacaaaggacatact
atgttaggggttgaacatggatttcgcggcttaattgagggtcacattaaagaattaaac
tggttaagtgtgcgaggatgggccactactggcggttctgaattggggactagccgcaag
attcctcaaggcaaagatttttatgcgatcgcacgtcaaatcgaacgccatgatattaat
ggattgctcatcatcggcggttggagtggctatcaagcggcttatcaactctactcccaa
tgtgaaacttttcccgctttcaatattccgattctctgtatccccgcctcgattaacaat
aatctccccggctgtgaattgagtattggggctgatactgccctcaataatatcatcgaa
gcggtggataaaatcaagcaatctgctgttgcctccaaccgttgctttttagtcaaggtt
atgggacgttactgcggatacttagcggtgatgagtggcttggcaaccggggcggaacgg
gtgtatattaatgaggaaggggttgccctcacggatttgcaaaaagacctctccactctg
atttctggctttaaacaagggaaacgagtcggtttgattatctgtaatgaaaatgctcat
ccggtgtatgatagcgacttcatctgtgatttgtttgcggaagaaggtaaagaagtgttt
caagtgagggaagccattttaggccatctgcaacaaggcggcgacccgaccccctttgat
cgcattcaagcgacccggttctcggcgatcggtcttgactttctcatcgaacaagccaaa
agaccctcacccacaggggctttcatgggaaccgaagccggaaatgtgcgatttgttgac
ctggggatgattccccggatggtagacaaagaacaccaacgacccaaggaacaatggtgg
atggaaaccgctgcgatcgggaaaattctcgctcactatgcacctccaattgaaggttaa

DBGET integrated database retrieval system