KEGG   Ochrobactrum anthropi OAB: DR92_1483Help
Entry
DR92_1483         CDS       T03251                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:oah00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DR92_1483
Enzymes [BR:oah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DR92_1483
Transporters [BR:oah02000]
 Other Transporters
  Pores ion channels [TC:1]
   DR92_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C Tom37 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIK44153
UniProt: A0A011UH71
LinkDB All DBs
Position
1:complement(1543186..1543806)
Genome map
AA seq 206 aa AA seqDB search
MAELKLYTNPMSRGRIARWMLEEIGKPYDVEILDFGPPMKGPDYCTINPMGKVPALRHGD
AVVTEVAAICAYLATTFPEAGLAPHPNERADFFRWLFFTSGPVEAALSNHALGFEIPADK
QGMVGYGNYDTVVNTLEKAVSHHPYITGDRFTAADVYVGSHIGWGLRFGTLPARGAFVAY
WDRLKDRPAMKRATELDEAAAAATQH
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttgaagctctataccaacccgatgtcgcgcggacgcatcgcgcgctggatg
ctggaggagatcggcaaaccctatgatgtggaaattctggatttcgggccaccgatgaag
gggcctgactactgcacaatcaatccgatgggcaaagttcctgccctgcgccacggcgat
gcggtggtgacggaagtggctgcaatctgcgcctatctggcaacaacatttcccgaagct
ggtctggcgcctcaccccaatgagcgcgcggatttcttccgctggctgttctttacatct
ggtcctgtggaagccgccttgtccaaccatgcgctcggctttgaaatccccgcagacaag
cagggaatggtcggctacggcaattacgatacagtggtcaacacattggagaaagcggtt
tcgcaccatccatacatcaccggcgaccgcttcacggcggctgacgtttatgtcggctcg
cacatcggctggggcctgcgcttcggcacgttgccggccagaggagcgttcgtcgcctat
tgggaccgactaaaagatcgccccgccatgaagcgcgccacggaactggacgaggcagca
gcagcagccactcagcattaa

DBGET integrated database retrieval system