KEGG   Ochrobactrum anthropi OAB: DR92_443Help
Entry
DR92_443          CDS       T03251                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
oah  Ochrobactrum anthropi OAB
Brite
KEGG Orthology (KO) [BR:oah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DR92_443
Enzymes [BR:oah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DR92_443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13 Folliculin
Motif
Other DBs
NCBI-ProteinID: AIK45375
UniProt: A0A011V5N4
LinkDB All DBs
Position
1:466004..467119
Genome map
AA seq 371 aa AA seqDB search
MMSKSLKIWFAAVGLSATALASAAANPSIAVDVATGKVYQQQEAFQRWYPASLTKMMTAY
VAFRALQSGQMTLDSPVRMTVNAAKEPPSKMGYKPGSVMTLDTALKIMLVKSANDVAVAV
AEAVGGTESGFVQRMNAEAQRIGMVGSHFANPNGLHNPNNYTTARDLAVLAVQLRREFPQ
YAHYFATEAIDPGAGKKVQANYNILLGRYDGADGMKTGFVCASGFNLASSATRNGRTVLA
IVLGADRQEARAVQAAQLMTDAFRANASGGATLATLRPAAGGNLNQAVDMRKAICSQQAM
ADRWDGRDVEGKLKINSPYIHAMDRDPVPVRVGLVSEPGPTTRPSQLDISQIPVPMPRPQ
RSAGANTTAIN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgaaatcattgaaaatctggtttgcagctgttggcttgtccgcgaccgcactg
gcgtccgccgccgctaatccctcgatcgcagtggatgtggcaacaggcaaggtctaccag
cagcaggaagcttttcagcgctggtatcccgcttccctgaccaagatgatgacggcctat
gtggcattccgtgcgcttcagtcgggccagatgacgctggattcgccggtgcgcatgacg
gtcaacgccgccaaggaaccgccgagcaagatgggctacaagccgggatcggtcatgacg
ctcgatacggcgttgaagatcatgctggttaagtcggccaatgatgttgcggtggccgtt
gccgaggccgtgggcggaacggaatccggtttcgtgcagcgcatgaatgcggaagcgcag
cgtatcggtatggtcggctcgcatttcgccaatccgaacggcttgcataatcccaataac
tacacaacggctcgcgacctcgcggttctggccgtgcagctgcgccgcgaatttccgcaa
tatgcgcattattttgcgaccgaggcgatcgatccgggcgcgggcaagaaagttcaggcc
aattacaacatcctgcttggccgctatgacggggcggacgggatgaagaccggcttcgtc
tgtgcatccggcttcaatcttgcaagttcggccacgcgcaacggtcggaccgtgctggca
attgttctcggtgcggaccggcaggaagcgcgcgcggttcaggcagcacagctgatgact
gacgctttcagggcaaatgcgagcggtggcgctacattggcgaccttgcgccccgcagcc
ggcggaaatctcaatcaggccgtcgatatgcgcaaggctatctgcagccagcaggccatg
gccgatcgctgggacggtcgcgatgtcgagggtaagctgaaaatcaattcgccttatatc
catgcgatggatcgcgatccggttccggttcgcgtcggtctggtttccgaaccgggtccg
acgacccgcccgagccagctcgacatttcgcagattccggtgccaatgccgcgtccgcag
cgttccgccggtgccaataccaccgcgatcaactga

DBGET integrated database retrieval system