KEGG   Ochrobactrum anthropi OAB: DR92_474Help
Entry
DR92_474          CDS       T03251                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00020  Citrate cycle (TCA cycle)
oah00310  Lysine degradation
oah00380  Tryptophan metabolism
oah01100  Metabolic pathways
oah01110  Biosynthesis of secondary metabolites
oah01120  Microbial metabolism in diverse environments
oah01130  Biosynthesis of antibiotics
oah01200  Carbon metabolism
Module
oah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR92_474 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    DR92_474 (sucA)
   00380 Tryptophan metabolism
    DR92_474 (sucA)
Enzymes [BR:oah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     DR92_474 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIK44325
UniProt: A0A011UCG0
LinkDB All DBs
Position
1:498911..501916
Genome map
AA seq 1001 aa AA seqDB search
MARQEQANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKN
AEGASWTRKNWPIAANGELISALDGNWAEVEKHVTDKLKGKAAKGEAKGATGAALTSEEI
TQAARDSVRAIMMIRAYRMRGHLHANLDPLGLSEKPNDYNELEPENYGFTPADYNRKIFI
DNVLGLEYATVPEMLDILKRTYCGTIGVEFMHISDPAEKAWIQERIEGPDKKVAFTPEGK
KAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGAMGVKEIIFGMAH
RGRLNVLSQVMGKPHRAIFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLT
ANPSHLEIVNPVVMGKARAKQDLLAGRTRDDMVPLATRAKVLPLLLHGDAAFAGQGVVAE
CLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEA
VVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMYKAIRAHKTTVQLYSD
KLIAEGLIKQEEIDQMKAQWRENLETEFDAGQSYKPNKADWLDGAWAGLRTADNADEQRR
GKTAVPMKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSL
VAEGSPIRLSGQDVERGTFSQRHTVLYDQETQNRYIPLNNIQKGQAIYEAINSMLSEEAV
LGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEG
QGPEHSSARLERWLQMCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLIMMTPKSLLRH
KRAVSTLNELSGESSFHRLLWDDAQYNKDEGIKLQKDAKIRRVVLCSGKVYYDLYEEREK
RGIDDVYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFIDPYLEWVLAH
IDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAFLEDALGN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcaagaacaagccaacgacgttttcgcccttacctcattcctctatggcggc
aatgccgactatattgaggagctgtacgccaagtatgaggacgatccgaattcggtcgat
ccgcagtggcgcgatttcttcgcgaagctgggcgacaatgccgacgatgtgaagaaaaac
gctgaaggcgcgtcctggaccaggaagaactggccgattgcagccaatggcgaactgatt
tccgcgctcgatggcaactgggctgaagttgaaaagcacgtcaccgacaagctgaaaggt
aaggctgcaaagggcgaagcgaagggtgctaccggcgcggctcttaccagcgaagagatc
acgcaggctgcacgcgacagcgttcgcgccatcatgatgatccgcgcctaccgcatgcgt
ggccatctgcacgccaatctcgatccgctcggtctctccgaaaagccgaacgactataat
gagctggagccggaaaactacggtttcacgcctgccgactacaaccgcaagatctttatc
gacaacgtgctcggcctcgaatatgcgaccgtgccggaaatgctcgacattctgaagcgt
acctactgtggcacgatcggcgtcgaattcatgcatatctccgatccggctgaaaaagcc
tggattcaggaacgcatcgaaggtccggataaaaaggttgctttcacgccggaaggcaag
aaggccatcctgtcgaagctgatcgaagcggaaggcttcgagcagttcatcgacgtcaaa
tacaagggcaccaagcgtttcggcctcgatggtggtgaatcgctgatcccggcccttgag
cagatcgtcaagcgcggcggcgccatgggtgtcaaggaaatcatcttcggcatggcccat
cgtggccgtctgaacgtgcttagccaggtcatgggcaagccgcatcgcgctatcttccac
gaattcaagggcggctcctatgcgccggacgacgtggaaggctcgggcgacgtgaagtac
catctgggcgcttcgtcggaccgtgaattcgacggcaacaaggtccacctgtcgctgacc
gccaacccgtcgcacctcgaaatcgtcaaccccgtcgtgatgggcaaggcccgtgccaag
caggacctgctggctggtcgcacccgtgacgacatggttccgcttgcaacgcgcgccaag
gttttgccgctgctcctgcatggcgatgctgcctttgccggtcagggtgttgtggccgag
tgccttggcctttcgggcctgaaggggcaccgcgtcgccggtacgctgcatttcatcatc
aacaaccagatcggtttcaccaccaatccggccttctcgcgttcgtcgccttatccgtcg
gatgttgcgaagatgatcgaagcgccgatcttccacgtcaatggcgacgatccggaagcc
gtggtgttcgctgccaaggttgcgaccgaattccgcatgaccttccacaagccggtggtc
atcgacatgttctgctatcgccgcttcggtcacaacgaaggcgacgagccgtccttcacc
cagccgttgatgtacaaggcgatccgtgcacacaagaccacggttcagctctacagcgac
aagctgattgctgaaggcctgatcaagcaggaagaaatcgaccagatgaaagcgcagtgg
cgcgaaaatctggaaaccgaattcgacgccggacagagctacaagccaaacaaggccgac
tggctggacggcgcttgggctggcctgcgcaccgccgacaatgccgacgaacagcgtcgc
ggcaagaccgccgtaccgatgaagacgctcaaggaaatcggcaagaagctggttgaagta
ccgaaggacttccacgtccatcgcacgatccagcgcttcctcgacaaccgtgccaagatg
atggaaacgggcgaagggatcgattgggcgacggctgaatcgctggcattcggctcgctg
gttgctgaaggcagcccgatccgcctgtccggtcaggacgtcgaacgcggcaccttctcg
cagcgtcacacggttctctacgatcaggaaacccagaaccgttacatcccgctcaacaat
atccagaagggtcaggcgatctacgaggccatcaactcgatgctctcggaagaagcagtg
ctgggctacgaatacggctattcgctgtccgacccgcgcgctctggttctgtgggaagcc
cagttcggcgatttcgccaatggtgcacaggtcgtgttcgaccagttcatctcgtcgggc
gaacgcaagtggctgcgcatgtccggtctcgtctgccttctgccgcacggctatgaaggt
cagggtccggaacactcctcggctcgtctggaacgctggttgcagatgtgtgcggaagac
aacatgcaggtggccaacgttacgacgccggctaactacttccatattctgcgccgccag
atgaagcgcgacttccgcaagccgctcatcatgatgacgccgaagtcgctgctgcgtcac
aagcgtgcagtttcgaccctcaacgaactgtcgggcgaatcctcgttccaccgtctgctg
tgggacgatgcgcagtacaacaaggacgaaggcatcaagctccagaaggatgcaaagatc
cgtcgcgtcgttctctgctcgggcaaggtctattacgacctttacgaagagcgtgaaaag
cgtggcatcgatgacgtctacctgctgcgtgtcgaacagctttatccgtttccggccaag
gcactcatcaatgagctgtcacgcttccgccatgcggaaatggtctggtgtcaggaagag
ccgaagaacatgggcgcatggtcgttcatcgacccgtatctggaatgggtgctggctcat
atcgacgccaagcatcagcgcgtgcgctatgcaggccgtccggcggcagcatcgcctgca
acgggtctgatgtcgaagcatcttgcgcagctcgccgctttccttgaggatgcgctcggt
aactga

DBGET integrated database retrieval system