KEGG   Oleispira antarctica: OLEAN_C08000Help
Entry
OLEAN_C08000      CDS       T04028                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
oai  Oleispira antarctica
Brite
KEGG Orthology (KO) [BR:oai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OLEAN_C08000 (ahpF)
Enzymes [BR:oai01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OLEAN_C08000 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin NAD_binding_7 K_oxygenase Thi4 NAD_binding_8 Thioredoxin_9 NAD_binding_9 FMO-like Shikimate_DH Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: CCK74976
UniProt: R4YKE9
LinkDB All DBs
Position
complement(865808..867403)
Genome map
AA seq 531 aa AA seqDB search
MLDQAMKDQLKAYLDNLKTDIHLVLSLDDSDTSNKLHGLANDIASLNNKVKVIEDQSASV
RKPIMQVINPIKETSIGFAGLPMGHEFTSLVLALLHSGGHPMKLEPEVIEQIAGLDKEMN
FEIFISLSCQNCPDVVQALNMMAAINPKITTTMIDGGAFQDEIAQRNIMAVPSVYLNGEV
FAQGRISLAEILAKVDTGSVAKEAAALNEKEPYEVLVVGGGPAGASAAIYAARKGIRTGV
VADRFGGQVLDTMSIENFISVKETEGPKLAAALEEHVKEYDVDIINQQKANNVISAEKTE
DGYIHVELESGATLKSRSVILSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGIEAAIDLAGLVEHVTVLEFSDTLRADKIIVDKANSMGNVEIIKQAQTTEVLG
DGTRVTALNYTDRTTGETKKIELAGIFVQIGLVPNSEFLKGSEIELSSRGEIEVSPKGET
SMPGVFAAGDVTTVPYKQIIIAMGEGSKASLGAFDYLIRTPVPNHRAINAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcaatgaaagaccaattaaaggcgtatttagataacttaaagaccgat
atacatctggttcttagccttgatgacagtgatacctcgaataagctacacggcctagcg
aatgacattgcatcactgaataacaaagtaaaagtgatcgaagatcaaagcgccagtgtc
cgtaaacctattatgcaggtcattaacccaatcaaagaaacatctatcggtttcgctggt
ttacctatgggtcacgaatttacttcattagtattggcattgctgcacagcggtggccat
ccaatgaagctagagccagaagtgattgaacaaattgcaggcttagacaaagaaatgaac
tttgaaatattcatttcacttagctgccagaattgccccgatgtcgtacaagccttaaac
atgatggcggcgattaatcctaaaatcacaacaaccatgatcgatggcggcgctttccaa
gacgaaattgcccagcgcaacatcatggcagtacccagcgtttacctaaacggtgaagtg
tttgctcaaggtcgaatatctttagctgaaattctagcgaaagtagataccggctctgtc
gcaaaagaagccgctgcgttaaacgaaaaagaaccgtacgaagtattagttgtgggtggt
ggtcctgcgggtgcatctgctgcaatttacgcagcgcgtaaaggcatccgcaccggagtt
gttgcagaccgttttggtggccaagtactcgatacaatgtcgattgaaaacttcatttca
gtgaaagaaacagaagggcctaagttagcggcggcactagaagaacatgttaaagaatat
gacgtagacatcatcaatcagcaaaaagcgaacaacgtgatttcagctgaaaaaaccgaa
gatggctatattcatgttgaactagaaagtggcgcaaccttaaaaagccgcagtgtgatt
ctatcgactggcgcacgctggagagagatgaacgtaccgggcgaacaagaataccgcaat
aaaggtgttgcctactgcccacactgtgatggcccgttatttaaaggtaaaagagtggcc
gttattggtggtggtaactctggtatagaagcggcgattgatcttgccggtttagtagag
cacgtaaccgtattagaattttccgataccttacgagccgataaaataatagttgataaa
gccaatagcatgggcaatgtcgaaattattaaacaggcacaaacaaccgaagtgctgggg
gatggcactcgagtaaccgcgttgaactataccgaccgaacaacaggtgaaactaagaaa
attgaactggcaggaatcttcgtacaaattggtctagtgccaaacagcgaattcctaaaa
ggttcagaaattgaactatcaagccgtggtgagattgaagtaagccctaaaggtgaaacc
tcaatgccgggtgtatttgcagcgggggacgtaacgaccgtgccttataaacaaatcatc
atagccatgggtgaaggctcaaaagctagcctaggtgctttcgattatttgattcgcaca
ccagtgccgaaccatcgcgctattaatgcagcataa

DBGET integrated database retrieval system