KEGG   Oleispira antarctica: OLEAN_C16820Help
Entry
OLEAN_C16820      CDS       T04028                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
oai  Oleispira antarctica
Pathway
oai00020  Citrate cycle (TCA cycle)
oai00190  Oxidative phosphorylation
oai00650  Butanoate metabolism
oai01100  Metabolic pathways
oai01110  Biosynthesis of secondary metabolites
oai01120  Microbial metabolism in diverse environments
oai01130  Biosynthesis of antibiotics
oai01200  Carbon metabolism
Module
oai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oai_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OLEAN_C16820 (sdhA)
   00650 Butanoate metabolism
    OLEAN_C16820 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OLEAN_C16820 (sdhA)
Enzymes [BR:oai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OLEAN_C16820 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     OLEAN_C16820 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 DAO GIDA Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCK75858
UniProt: R4YRG7
LinkDB All DBs
Position
1845987..1847759
Genome map
AA seq 590 aa AA seqDB search
MSTKIRTLSYDAIVIGGGGAGMRAALQLTEAGIKTACVTKVFPTRSHTVSAQGGITCAIA
SADPDDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPQAVFELEHMGLPFSRTEEGRIYQR
PFGGQSKGPNDSTQAARTCAAADRTGHALLHALYQGNLKGGTTFLNEWYAVDLVKNAKGQ
VAGVIAIDIETGETVYIKAKATVLATGGAGRIYQSTTNALINTGDGVGMAIRAGVPMQDI
EMWQFHPTGIAGAGTLVTEGCRGEGGYLVNKDGERFMERYAPNAKDLAGRDVVARSMVLE
ILEGRGCGEDGDHVFLKLDHLGEETLNAKLPGILELSRTFAHVDPVKEPIPVVPTCHYMM
GGVPTNIGGQALTQVDGKDVIIEGLYAAGEIACVSVHGANRLGGNSLLDLVVFGRAVGIQ
IEQNFKEGFESIDASEEDIERAMARLNRLNYSTSGEDVAKVRADLQKTMQLYFGVFRDGD
SMVKGLGLLDEIEKRVRNTVLDDKSGAFNTARIEALELDNLFETAYATAIAAIERKESRG
AHARNDYTERDDVNWLCHSLYFPETKTIGKRDVNFAPKTVPPFEPKIRVY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaagattcgtactttatcctatgacgctatcgtaattggtggcggtggtgca
ggcatgcgtgccgcactgcagttgacagaagcgggtattaagaccgcttgtgtgactaaa
gtattcccgacgcgttcgcacacagtatccgctcaaggcggcattacgtgtgcaatcgca
tctgctgatccggatgatgattggcgctggcacatgtacgataccgttaagggttccgac
tatatcggtgaccaagacgctatcgaatacatgtgttcagtaggtccgcaagccgtgttt
gaattagagcatatgggtttacctttctctcgtactgaagaaggccgtatttatcagcgt
cctttcggcggtcagtctaaggggccaaatgattcaactcaggctgctcgtacttgtgca
gcggctgaccgtactggtcacgcgttattgcacgccttgtatcaaggcaaccttaagggt
ggcactaccttcttaaacgaatggtatgcggttgatttggttaaaaacgcaaaaggtcag
gttgcgggtgttatcgctattgatattgaaacgggcgaaactgtttatatcaaagcgaaa
gcaacagtattggcgactggcggcgcaggtcgtatttaccagtcaactacgaatgctttg
atcaatactggtgacggtgttggtatggcaattcgtgctggcgttccaatgcaagacatt
gaaatgtggcagttccacccaaccggtattgcaggtgcaggtacgcttgtaacggaaggt
tgtcgtggtgaaggcggttacttagtcaataaagacggtgagcggttcatggagcgttat
gctccaaacgccaaagatcttgcaggtcgtgacgttgttgctcgatctatggttctagaa
attctagaaggccgtggttgtggtgaagatggcgatcatgtattccttaagctagatcat
ttaggtgaagaaacgttgaatgccaaacttccaggtattcttgagctttctcgtaccttc
gcgcacgttgatccagtgaaagaaccgattcctgttgtaccaacatgtcactacatgatg
ggtggcgtaccgactaatatcggtggtcaggcattgactcaagtagacggcaaagacgtt
attatcgaaggcctatacgccgccggtgagatcgcttgtgtatcggtacacggcgcaaac
cgtttaggtggtaactcactgcttgatttggtggtattcggtcgtgcagtaggcattcag
attgagcaaaactttaaagaaggttttgaatcgattgatgctagcgaagaagatatcgaa
cgcgcaatggctcgtttgaatcgtctaaactactccacctctggtgaagatgtcgctaag
gttcgtgctgacttgcaaaaaacgatgcagttatatttcggtgtattccgtgatggcgac
agcatggttaaaggtttgggtctattagacgaaatcgaaaagcgtgttcgcaatacggtt
cttgacgacaagagcggtgcgtttaacacagctcgtatcgaagcgcttgaacttgataat
ttgtttgagacggcttacgcaacggcaattgctgctattgagcgtaaagaatctcgcggt
gctcatgcccgtaacgattataccgaacgtgacgatgtgaattggttatgccactcattg
tatttcccagaaactaaaaccattggtaagcgtgatgtgaactttgcacctaagactgtg
cctccgttcgaaccgaaaatccgtgtttattaa

DBGET integrated database retrieval system