KEGG   Oleispira antarctica: OLEAN_C16830Help
Entry
OLEAN_C16830      CDS       T04028                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
oai  Oleispira antarctica
Pathway
oai00020  Citrate cycle (TCA cycle)
oai00190  Oxidative phosphorylation
oai00650  Butanoate metabolism
oai01100  Metabolic pathways
oai01110  Biosynthesis of secondary metabolites
oai01120  Microbial metabolism in diverse environments
oai01130  Biosynthesis of antibiotics
oai01200  Carbon metabolism
Module
oai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oai_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OLEAN_C16830 (sdhB)
   00650 Butanoate metabolism
    OLEAN_C16830 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OLEAN_C16830 (sdhB)
Enzymes [BR:oai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OLEAN_C16830 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     OLEAN_C16830 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: CCK75859
UniProt: R4YTJ7
LinkDB All DBs
Position
1847774..1848484
Genome map
AA seq 236 aa AA seqDB search
MLVSIYRYNPEKDEAPYMQDYEISIPVGKDLMVLDVLNLVKEQDSSVSYRRSCREGVCGS
DGMNINGKNGLACITPISEATKGKNDKLVLRPLPGMPVIRDLVIDMALFYKQYESIKPYL
NNNTPAPAIERLQSPEERAKLDGLYECILCACCSTACPSFWWNPEKFVGPAGLLQAYRFL
ADTRDTSTEERLAELDDPFSVFRCRGIMNCVNVCPKGLNPTRAIGHIRGMLLQREI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgttagttagtatttatcgctacaatcctgagaaagatgaagcgccttacatgcaagac
tacgagatctctatccctgtgggtaaagaccttatggttttggatgtactaaacctagtt
aaggagcaggattcttctgtttcttaccgtcgctcatgccgtgaaggtgtgtgtggttca
gatggtatgaacattaacggtaaaaatggtttggcgtgtattactccaatctctgaagct
actaaaggtaaaaacgacaagctagtcttgcgtccattgcctggtatgcctgtgattcgt
gaccttgttatcgatatggcgcttttctacaaacagtatgaaagcatcaaaccatacctg
aataacaatacgccagcgcctgctattgagcgtttgcagtcaccagaagagcgcgcaaag
ttagatggcctatacgagtgtatcttgtgtgcatgctgttcaactgcgtgtccatctttc
tggtggaatcctgagaaattcgttgggccagcgggcttattgcaagcttatcgctttcta
gcggatactcgagatacctcgacagaagaaagattggctgaattggacgatccatttagc
gtttttcgttgccgtggcatcatgaactgtgtcaatgtatgcccgaaaggtttaaaccct
acgcgagcaatcggacacattcgtggaatgttgttgcaacgcgagatctaa

DBGET integrated database retrieval system