KEGG   Oleispira antarctica: OLEAN_C19390Help
Entry
OLEAN_C19390      CDS       T04028                                 

Gene name
pmpM
Definition
(GenBank) MATE efflux family protein
  KO
K03327  multidrug resistance protein, MATE family
Organism
oai  Oleispira antarctica
Brite
KEGG Orthology (KO) [BR:oai00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oai02000]
    OLEAN_C19390 (pmpM)
Transporters [BR:oai02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   OLEAN_C19390 (pmpM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE
Motif
Other DBs
NCBI-ProteinID: CCK76115
UniProt: R4YMX1
LinkDB All DBs
Position
2117529..2118896
Genome map
AA seq 455 aa AA seqDB search
MTNTKSEASVALSKQHVKQLYALTAPILITQLAQIGMATIDTIMSGHVGTEDLAAIAIGS
SLWTPILLFVAGIMVAFTPQVAKLVGANQTDKVGDILGSAVMVGIAFGCLTGLLLYFFGP
MLSYLLADPHSAMLMREYVEAVAWGLPAAGGFLALRFHAEALNQPGAVTRIMLAGLLLNI
PANGLFVYGWLGVEPMGGAGCGYGTLLVFHFLFIAMLINCYKHRLPPHQRKLATFFTMKR
ESVISLIALGIPIGSAIFFEVSFFSVIALFLTPLGTEVVAGHQVAINMSSLTFMVPLSVG
MAITVMVSQQLGREQADEAASISWLGMRVNISLAVLNASLIILLAPYIAQLYSSDPEVVK
IGAALLVFAAIFQISDAIQIAAAGALRGYQDTIIVMIITFFSYWLCGIGLGYYLTFETAE
PLGAKGFWIGIIVGLTFAAIMLSYRLHKVSKKALK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataccaaatccgaagcaagtgttgctttatcaaagcaacacgttaagcagctc
tacgctctaacggcccctattctgattacgcagcttgcgcaaatcggcatggcgaccatt
gataccatcatgtctggtcacgtaggcactgaggatctcgccgccatcgcaattggctct
agtttatggacgccgatcttattgtttgtggcgggcattatggtggcgtttacgccgcaa
gtcgccaagctggtgggcgctaatcaaaccgataaagtaggtgatattttaggctctgca
gtaatggtcgggattgcgtttggctgccttacgggcttactgctttatttctttggtcca
atgctgagttatttactggccgatccgcacagcgccatgctgatgcgcgaatacgtagaa
gctgtcgcttggggtttacccgcagcaggtggatttttagcactacgattccacgcagag
gcgctgaatcagcccggtgctgtcacgcgaatcatgctcgcaggcctattactgaacatc
cccgccaacggcctgtttgtttatggctggctgggagttgagcccatgggcggtgccggc
tgtggttacggcaccctgctagttttccactttttgttcattgccatgttaattaattgc
tataaacatagattaccgcctcatcagcgtaaactagccacgtttttcaccatgaaacgt
gaatccgttattagcttgattgcactgggcattcctattggcagcgccatcttttttgaa
gtcagctttttctcagtgatcgcactctttttaacaccgctcggaaccgaggtggttgct
gggcatcaagtcgctatcaacatgtcgtcccttacctttatggtgccattaagtgtcggc
atggccataaccgtcatggtcagtcagcaattggggcgcgagcaagctgatgaagcggcc
agtatttcgtggttgggaatgcgggttaatatttcactcgcggtattaaatgcgagcttg
attattttattagcaccgtacattgcccagctgtactcatccgatcctgaagtcgtaaaa
attggcgccgcgttattagtatttgccgctatttttcaaatcagcgacgccatacaaatc
gccgccgctggggcattacgcggttatcaagatacgattattgtgatgataattacgttt
ttctcttattggttatgcggtataggcttaggatattatttgaccttcgaaacggctgaa
ccactaggggcaaaaggtttttggataggaataattgtgggcttaacctttgcagcaatc
atgttgagctatcgtttacataaggtgagcaaaaaagccctgaagtaa

DBGET integrated database retrieval system