KEGG   Oleispira antarctica: OLEAN_C26070
Entry
OLEAN_C26070      CDS       T04028                                 

Definition
(GenBank) OmpA family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
oai  Oleispira antarctica
Pathway
oai03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:oai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OLEAN_C26070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oai02044]
    OLEAN_C26070
Secretion system [BR:oai02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   OLEAN_C26070
SSDB
Motif
Pfam: DotU OmpA Pox_A14
Other DBs
NCBI-ProteinID: CCK76783
UniProt: R4YT81
LinkDB
Position
2931532..2932890
AA seq 452 aa
MSQDDRFFQDNNATDDDSDRTVFISRPASNRQRNRASSPPPAQPAFSQQQPVPPPMQQSR
SISEVSLHSDVNVIVSAATPLLTLGINVRSMSHHPDPKALYQQIAESLKNIDLQLKNQGL
PKESIISARYIICAYLDEMVMSTPWGGQSLWATRNLLMTFHKNNQGGAQFFEIIKLLTQS
PAMNLDLIELCYLVLDLGFQGRYRISDTGSIEIASIQDNLYQIISTYRPAPVKQLSNHWR
GAINDQKKSLSGNNRLFITAGIALLITAIVFTLFLMLLSQKSDPVAIKAASVASNLQPIV
RNNRPIKRTTHLSYIRDQLNHDITQKNLSVEDISGGVRIIVFGSNLFKSSTAKLTRQKEI
TVANIIATLKNTPGFIQITGHTDDIPIRTLQFPSNWELSKKRADEIVKLLQKQMPDREIV
GEGVADSAPIVPNNSRENRAINRRIEINLYTI
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgagccaggatgatcgtttctttcaggataacaatgctacggacgatgacagtgaccgt
accgtattcatttcgcgcccggcgagcaatcgtcagcgtaaccgtgcaagctcaccaccg
ccagcacaacctgcgtttagtcagcaacaacctgtgccgcctccaatgcaacagtctcga
tcaatatctgaagtatctctgcactcagacgtcaacgttattgtttcagcggcaactcct
ctactaacgctgggcattaacgttcgttcgatgagtcatcacccagaccctaaagccctt
tatcaacaaatagccgaaagtttgaaaaatatcgacttgcagctaaaaaatcaaggactg
ccaaaagaatcgatcattagcgcacgctatataatttgtgcctatttagatgaaatggtt
atgtcgacaccttggggtgggcaaagtctatgggccactcgtaatctgttaatgactttt
cataagaataatcaagggggtgctcaattttttgaaattattaaactgctaacccaaagc
cccgcgatgaatcttgatttaatagagctgtgctacctcgttttggatttaggttttcaa
ggccgttatcgtattagtgatacgggttccattgaaattgccagcattcaagataactta
tatcaaatcatctcaacttaccgtccagctcctgttaaacagctttctaatcattggcgt
ggcgcgatcaatgaccagaaaaagagtctgtcgggtaataatcgactattcataacagca
ggtattgcactgttaataaccgccatcgtctttaccttatttttaatgctgcttagtcaa
aaatcagatccagtagcgattaaagcagcatcagttgcgagtaacttacagcccattgtt
agaaacaaccgaccgatcaagcgcacaacacacttaagctacattcgcgatcaattaaac
catgacatcacccagaaaaacttgtctgttgaagatatttcaggcggcgttcgtatcatt
gtttttggatctaacttattcaaatcatcgactgccaagctcacaagacaaaaagaaata
acggttgctaatattattgccaccttaaaaaacacaccaggcttcatccagataaccggg
cataccgatgatattcccattagaacattacaatttccttctaattgggaactctcaaaa
aaacgtgcagatgaaatcgtgaaactgcttcaaaagcagatgcccgatagagaaattgtt
ggtgaaggtgtggctgattcagcgccaattgtacccaacaattcaagagaaaatagagcg
atcaaccgtcgaatcgaaattaacttatatacgatataa

DBGET integrated database retrieval system