KEGG   Oleispira antarctica: OLEAN_C26130Help
Entry
OLEAN_C26130      CDS       T04028                                 

Definition
(GenBank) hypothetical protein
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
oai  Oleispira antarctica
Pathway
oai00061  Fatty acid biosynthesis
oai00780  Biotin metabolism
oai01100  Metabolic pathways
oai01212  Fatty acid metabolism
Module
oai_M00083  Fatty acid biosynthesis, elongation
oai_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OLEAN_C26130
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OLEAN_C26130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oai01004]
    OLEAN_C26130
Enzymes [BR:oai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     OLEAN_C26130
Lipid biosynthesis proteins [BR:oai01004]
 Fatty acid synthase
  Component type
   OLEAN_C26130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCK76789
UniProt: R4YUL0
LinkDB All DBs
Position
2942467..2943597
Genome map
AA seq 376 aa AA seqDB search
MYIADFEICTPLSNDIAELSEKIQANDNEFCLSNYYGHLGQEINMSLCDSQSFSKLDPKI
NINRCHRDKTLVQMAGQALTPLLTRFKEYSPTLAPLILALAEQIPKHKPLAPEQLANSIR
QHLGENGDMIHWNQFMPVTIGRAGVLATLSLAQKLFQQNNGIELIIIGGLDSYRHSTVLS
DLSKQQRIAMIGSDGFVAGEGAGFLVVTNNKKYALKMNQGHVRIHPPGLAVEQGYIGSQE
PNLAQGLTSAIKTALDTSPSLPVNQIYSSMNGEAIWYEEHVASTLRHRHDLGGNIAEKTH
SVAYNIGDIGSATGALSIALSAHQLLSDGLPQRHLITTSSDKNQRSAMCLTFEPAEAKQN
TQKEAQDSVHNEQDDR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtacattgccgactttgaaatttgcaccccattaagtaatgacatagctgaactcagt
gaaaaaattcaagccaatgataatgaattttgcttatcaaattattatgggcatcttggc
caagaaataaacatgtcgctatgcgatagccaatctttcagcaaactagatccaaagatc
aatataaatcgctgccatcgagacaaaaccctcgtacaaatggctgggcaagcacttact
cccctactcactcgctttaaagaatacagccctacacttgcgccgttaattctcgcactg
gccgaacaaataccaaagcacaaacctctagcccccgaacagctcgctaattcaattagg
cagcacctaggtgaaaatggagacatgattcattggaaccaatttatgcctgtcaccatc
ggccgcgcaggtgttttagccacattaagcttggcgcaaaaactgtttcaacaaaataac
ggcattgagctaatcatcattggcggcctagacagctatcgccattcaaccgtactcagc
gatctaagcaaacaacaacgcattgccatgataggaagtgatggctttgttgcaggcgaa
ggcgcaggctttttggtagtaacgaataataaaaaatatgcgttaaaaatgaatcaagga
cacgtacgaattcatcctcccggcctcgcggttgaacaaggctacattggcagccaagaa
cctaatctagcccaagggctaaccagcgcaataaaaacggctttagatacttcaccgagt
ctaccggttaatcaaatttacagctcaatgaacggtgaagcgatctggtatgaagaacat
gtcgccagtacactacgacataggcatgatttggggggaaacattgcagagaaaactcac
tcagtcgcgtacaatatcggggatattggctctgccactggcgccctctcaattgcattg
tcagcgcaccaactattaagtgacggtttaccccagcgtcacttaattacaaccagttca
gataaaaatcaacgcagcgcaatgtgcttaacatttgaaccggcagaagcaaaacagaac
acgcaaaaagaagcacaggacagtgtacataacgaacaggatgatcgatag

DBGET integrated database retrieval system