KEGG   Oleispira antarctica: OLEAN_C35690Help
Entry
OLEAN_C35690      CDS       T04028                                 

Definition
(GenBank) Histidine-tRNA ligase
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
oai  Oleispira antarctica
Pathway
oai00340  Histidine metabolism
oai01100  Metabolic pathways
oai01110  Biosynthesis of secondary metabolites
oai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    OLEAN_C35690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: CCK77745
UniProt: R4YS31
LinkDB All DBs
Position
complement(4017719..4018897)
Genome map
AA seq 392 aa AA seqDB search
MSTADRWLLPDGIEEVLPPQARGVEQLRRHLLDDFDRWGYDFVIPPALEYLDSLLTGTAR
DLDLQTFKVTDQLSGRLMGLSADTTPQTARIDAHSWAQEGVSRLCYCRTVFHAKAPSILA
GRTPTQIGAELYGEAGAGADIEIISLMLNTLQQAGLQDLHLDIGHVGIFKAFSAKAQLSN
VAEEKLFALLKVKCATDLDAWAEEYLTDPALTTAFKAIVRLQGGIEVLDQVAEKLAAVVP
EVTGIIEHLKQVCQAIAARYNVPMYFDFTDLRGYNYHTGLVFAAYVPGYGDAVAQGGRYN
ETGAVFGRARPATGFSADLKVLAQLGRFAPTQADIVKAPAPYGQQQEQELLDLIAELRAQ
GTRVEVQLSGELPTNAARIELKDGQWKLIESN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgccgatcgctggttattaccagatggcattgaagaagtgttgccaccacaa
gcgcgtggtgtagagcaactacgccgtcatttgttggacgattttgaccgttggggttat
gactttgttataccgccagcgttagaataccttgattccctgctaacaggcacagcacgt
gacctggacctgcagacgtttaaggtaaccgatcaactctctggccgtttaatgggcttg
agtgctgatacgacgccgcaaaccgcacgaattgatgctcatagctgggcacaagaaggc
gttagccgtttgtgctattgccgtacggttttccatgccaaagcccctagtatccttgcc
ggacgtactccgacgcaaattggtgctgagctttatggcgaagccggtgctggcgccgat
atcgaaattattagcctaatgctaaataccttacaacaagcgggattgcaggatttgcac
cttgatattggccatgtaggtattttcaaagcattttcggcaaaagctcagctgtctaac
gtggcagaagagaagctttttgcgctattgaaagtaaaatgcgcaacagatttagatgcg
tgggcagaagagtatttaactgaccccgcattgaccaccgcttttaaagcaatcgttcgc
ttgcagggcggtattgaagtacttgatcaagtggctgaaaaattagccgccgttgtgcct
gaagttactggcatcatcgaacacttgaagcaagtctgccaagcaatcgcagcacgctac
aatgtacctatgtactttgattttaccgaccttcgtggttacaactaccacacaggtttg
gtttttgcggcttatgtgccgggctatggtgatgcggttgctcaaggtggccgttacaat
gaaactggtgctgtctttgggcgagcgcgtccagctacgggattcagtgcggatttgaaa
gttttggcgcagctaggtcgctttgcaccgactcaagcggacatcgtcaaagcgcctgcg
ccttatggtcagcaacaagagcaagaattattagacttgattgccgagctacgtgctcag
ggcacgcgagttgaagtgcagctaagcggcgaattgccaaccaatgctgcgcgtattgag
ttaaaagacggtcagtggaaactgatcgaatccaattaa

DBGET integrated database retrieval system