KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0269Help
Entry
Oant_0269         CDS       T00568                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00564  Glycerophospholipid metabolism
oan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Oant_0269
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Oant_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8 Mqo
Motif
Other DBs
NCBI-ProteinID: ABS13000
UniProt: A6WVJ6
LinkDB All DBs
Position
1:277329..278840
Genome map
AA seq 503 aa AA seqDB search
MAQEKLFDIFVIGGGINGCGIARDAVGRGFSVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGMRPAWLLRLGLFLYDHLGGRKK
LPATRTLDMRSDPAAQPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAIIQTRTKVV
AARRDREYWTITLEDTGTHEREEVRARLLVNAAGPWADKVLQDVEGDRQLHNVRLVQGSH
IVVRKKFSDPRSYFFQNNDGRIIFAIPYEDEFTLIGTTDQDYQGDPAKVAITDGETDYLC
AAASEYFKEPVRRADIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARRLAEHMLEKIEHRLGQKGAPWTHAAPLPGGDFVDVEFERELQKVKVAYPFLTPA
HARRLFRQYGTRIRVLLGEATSLADLGQHFGADLYEAEVRYLLENEWAVSAEDILWRRTK
LGLRLNAADVSSLEEYLKPARVA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagagaaactatttgatatttttgtaatcggcggtggcatcaacggctgcggt
atcgcacgtgatgcggttggtcggggattttcagttggccttgccgagatgaacgatctg
gcaagtggcacctcatcgcgggcaaccaaactcattcatggtggattgcgctatctggag
cactatgaatttcgtctggtgcgcgaggcgctgatggagcgcgaggtgttgtgggccaat
gcaccccacatcattcatccgatgcgctttgtgctgccttatcataagggcggaatgcgc
cctgcatggctgttgaggctcgggctgttcctctacgaccatctgggcgggcgtaaaaag
ctccccgccacgcgtacgcttgatatgcgctcggacccggctgcgcagcccttgaaaccg
ctttttaccaaggcattcgaatattcggactgttgggtggatgacgcgcgtttcgttgcc
ttaactgcccgtgatgcagcggatcgcggagcgataatccaaacccgaaccaaggtcgtg
gcggcgcgccgtgacagggaatactggaccatcacgctcgaagataccggtacacatgag
cgcgaggaagttcgggctcgtctgctggtcaatgctgctggtccctgggcagacaaggtt
ctgcaggatgtcgaaggagatcgacagcttcacaatgtccggcttgttcagggcagccat
attgtggtgcgcaagaaattctccgatccccgttcctatttcttccagaacaatgacggg
cgtatcatattcgccatcccctacgaggatgagttcaccctgattggcacaaccgatcag
gactatcagggggacccggccaaggttgcgatcaccgatggtgagaccgactatctctgc
gcggcagccagcgaatatttcaaggagccggtcagacgcgcggatatcgtctggacctat
tccggtgtgcgcccgctttatgatgacggtgcaagcaaggcgcaggaagcaacgcgcgat
tatgtcctgaaagaagacgcacccgatgggcttgcacctctgatcaacgtttttggcggc
aagctgaccactgcgcggcgacttgccgaacatatgctggagaagatcgagcataggctg
gggcaaaaaggtgcgccgtggacccatgctgctccgttacccggtggtgatttcgtggat
gtcgagttcgagcgtgagctgcagaaggtgaaagttgcatatcctttcctgacgcctgct
catgcgcggcgcctgttccggcaatatggaacgcgtattcgtgttctgcttggggaagcc
acttcacttgccgaccttggacagcatttcggtgccgatctttatgaagccgaagtgcgg
tatctgcttgagaatgaatgggcggtgagcgccgaggatattttgtggcggcgtacgaaa
cttggtcttcgcctgaatgcggcggatgtttcctcgcttgaggaatatctgaagcctgct
cgcgtcgcctaa

DBGET integrated database retrieval system