KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0271Help
Entry
Oant_0271         CDS       T00568                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00010  Glycolysis / Gluconeogenesis
oan00620  Pyruvate metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_0271
   00620 Pyruvate metabolism
    Oant_0271
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Oant_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ABS13002
UniProt: A6WVJ8
LinkDB All DBs
Position
1:280047..281564
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPKSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAAKDAWGKTSAAERALILNRIADRIEENLPALAAAETWDNGKPIRETTAADLPLA
IDHFRYFAGVIRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMDLIGDLLPPGVINVVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDKFMEKALKRVNAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNILPGDLAGGYYVKPTVFKGTNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaagccggctttcgcaaaacgctacggaaac
ttcatcgggggcaaatgggtcgagcccaagtcgggccgctatttcgagaacacttcaccg
gtcaatggtcaggtgctttgcgaagtagcccgctcggatgccgctgatgtcgaagcggct
cttgatgcagcgcatgccgccaaggatgcctggggcaagacgagcgcggctgaacgcgcg
ctcatcctcaatcgcattgctgaccggattgaggaaaacctgcctgcgctcgctgccgcc
gaaacctgggacaacggcaagccaatccgcgaaaccaccgctgccgatcttcctctggcc
atcgaccatttccgctatttcgccggtgtgatccgcgctcaggaaggcagcatttccgaa
atcgaccacgacacggtcgcttatcatttccatgaaccactcggcgttgtcgggcagatc
attccgtggaattttccgcttctcatggcgacatggaagctcgctccggcacttgcggcg
ggcaactgcgtcgtcctgaaaccggctgaacagacaccggcatcgatcctcgtgctcatg
gatctgatcggcgatcttttgccccccggtgtgatcaatgtcgtcaatggttttggtctt
gaggcaggcaaaccgctcgcgtcgagcccgcgcatcgccaagatcgccttcaccggcgaa
acgacgacgggtcgattgatcatgcaatatgccagccagaacctcatcccggttacactg
gaactcggcggcaagtcgccgaatatcttcttcaaggatgtcgcagcggaagacgacgat
ttcctcgacaaggccatcgaaggctttgtgatgttcgcactcaatcagggcgaagtttgc
acgtgcccaagtcgcgcgctcatccatgaatcgatttacgacaagttcatggaaaaggcg
ctcaagcgcgtgaatgcaatcgtgcagggcgatccactcgatcctgccacgatgatcggt
gcacaggcttccagtgagcagctggaaaaaatcctgagctatcttgatatcggccgccaa
gaaggtgctgaagtgctggcaggtggcgagcgcaatattctgccgggcgatctggctggc
ggttattacgtcaagccaaccgtattcaagggcactaacaagatgcgcattttccaggag
gaaatctttggaccggtcgtgtctgttgcaaccttcaaggacgatgcggaagcgctatcg
attgccaacgatacgctttacggtctgggtgccggtatatggacgcgtgatggcacgcgt
gcctatcgcttcgggcgtgccattcaggccggtcgtgtgtggaccaattgctaccatgcc
tatccggcacatgcggcatttggcggttacaagcaatcgggtatcggtcgcgaaaaccac
ctcaaaatgttggatcactatcagaacaccaagaacatgctggtgagctacagcccgaag
aaactgggtttcttctag

DBGET integrated database retrieval system