KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0933Help
Entry
Oant_0933         CDS       T00568                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00020  Citrate cycle (TCA cycle)
oan00310  Lysine degradation
oan00380  Tryptophan metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01200  Carbon metabolism
Module
oan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oant_0933
  09105 Amino acid metabolism
   00310 Lysine degradation
    Oant_0933
   00380 Tryptophan metabolism
    Oant_0933
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Oant_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABS13654
UniProt: A6WXF0
LinkDB All DBs
Position
1:969767..972772
Genome map
AA seq 1001 aa AA seqDB search
MARQEQANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADDVKKN
AEGASWTRKNWPIAANGELISALDGNWAEVEKHVTDKLKGKAAKGEAKGATGAALTSEEI
TQAARDSVRAIMMIRAYRMRGHLHANLDPLGLSEKPNDYNELEPENYGFTPADYNRKIFI
DNVLGLEYATVPEMLDILKRTYCGTIGVEFMHISDPAEKAWIQERIEGPDKKVAFTPEGK
KAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGAMGVKEIIFGMAH
RGRLNVLSQVMGKPHRAIFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLT
ANPSHLEIVNPVVMGKARAKQDLLAGRTRDDMVPLATRAKVLPLLLHGDAAFAGQGVVAE
CLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEA
VVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMYKAIRAHKTTVQLYSD
KLIAEGLIKQEEIDQMKAQWRENLETEFDAGQSYKPNKADWLDGAWAGLRTADNADEQRR
GKTAVPMKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLAFGSL
VAEGSPIRLSGQDVERGTFSQRHTVLYDQETQNRYIPLNNIQKGQAIYEAINSMLSEEAV
LGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEG
QGPEHSSARLERWLQMCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLIMMTPKSLLRH
KRAVSTLNELSGESSFHRLLWDDAQYNKDEGIKLQKDAKIRRVVLCSGKVYYDLYEEREK
RGIDDVYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFIDPYLEWVLAH
IDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAFLEDALGN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcaagaacaagccaacgacgttttcgcccttacctcattcctctatggcggc
aatgccgactatattgaggagctgtacgccaagtatgaggacgatccgaattcggtcgat
ccgcagtggcgcgatttcttcgcgaagctgggcgacaatgccgacgatgtgaagaaaaac
gctgaaggcgcgtcctggaccaggaagaactggccgattgcagccaatggcgaactgatt
tccgcgctcgatggcaactgggctgaagttgaaaagcacgtcaccgacaagctgaaaggt
aaggctgcaaagggcgaagcgaagggtgctaccggcgcggctcttaccagcgaagagatc
acgcaggctgcacgcgacagcgttcgcgccatcatgatgatccgcgcctaccgcatgcgt
ggccatctgcacgccaatctcgatccgctcggtctctccgaaaagccgaacgactataat
gagctggagccggaaaactacggtttcacgcctgccgactacaaccgcaagatctttatc
gacaacgtgctcggcctcgaatatgcgaccgtgccggaaatgctcgacattctgaagcgt
acctactgtggcacgatcggcgtcgaattcatgcatatctccgatccggctgaaaaagcc
tggattcaggaacgcatcgaaggtccggataaaaaggttgctttcacgccggaaggcaag
aaggccatcctgtcgaagctgatcgaagcggaaggcttcgagcagttcatcgacgtcaaa
tacaagggcaccaagcgtttcggcctcgatggtggtgaatcgctgatcccggcccttgag
cagatcgtcaagcgcggcggcgccatgggtgtcaaggaaatcatcttcggcatggcccat
cgtggccgtctgaacgtgcttagccaggtcatgggcaagccgcatcgcgctatcttccac
gaattcaagggcggctcctatgcgccggacgacgtggaaggctcgggcgacgtgaagtac
catctgggcgcttcgtcggaccgtgaattcgacggcaacaaggtccacctgtcgctgacc
gccaacccgtcgcacctcgaaatcgtcaaccccgtcgtgatgggcaaggcccgtgccaag
caggacctgctggctggtcgcacccgtgacgacatggttccgcttgcaacgcgcgccaag
gttttgccgctgctcctgcatggcgatgctgcctttgccggtcagggtgttgtggccgag
tgccttggcctttcgggcctgaaggggcaccgcgtcgccggtacgctgcatttcatcatc
aacaaccagatcggtttcaccaccaatccggccttctcgcgttcgtcgccttatccgtcg
gatgttgcgaagatgatcgaagcgccgatcttccacgtcaatggcgacgatccggaagcc
gtggtgttcgctgccaaggttgcgaccgaattccgcatgaccttccacaagccggtggtc
atcgacatgttctgctatcgccgcttcggtcacaacgaaggcgacgagccgtccttcacc
cagccgttgatgtacaaggcgatccgtgcacacaagaccacggttcagctctacagcgac
aagctgattgctgaaggcctgatcaagcaggaagaaatcgaccagatgaaagcgcagtgg
cgcgaaaatctggaaaccgaattcgacgccggacagagctacaagccaaacaaggccgac
tggctggacggcgcttgggctggcctgcgcaccgccgacaatgccgacgaacagcgtcgc
ggcaagaccgccgtaccgatgaagacgctcaaggaaatcggcaagaagctggttgaagta
ccgaaggacttccacgtccatcgcacgatccagcgcttcctcgacaaccgtgccaagatg
atggaaacgggcgaagggatcgattgggcgacggctgaatcgctggcattcggctcgctg
gttgctgaaggcagcccgatccgcctgtccggtcaggacgtcgaacgcggcaccttctcg
cagcgtcacacggttctctacgatcaggaaacccagaaccgttacatcccgctcaacaat
atccagaagggtcaggcgatctacgaggccatcaactcgatgctctcggaagaagcagtg
ctgggctacgaatacggctattcgctgtccgacccgcgcgctctggttctgtgggaagcc
cagttcggcgatttcgccaatggtgcacaggtcgtgttcgaccagttcatctcgtcgggc
gaacgcaagtggctgcgcatgtccggtctcgtctgccttctgccgcacggctatgaaggt
cagggtccggaacactcctcggctcgtctggaacgctggttgcagatgtgtgcggaagac
aacatgcaggtggccaacgttacgacgccggctaactacttccatattctgcgccgccag
atgaagcgcgacttccgcaagccgctcatcatgatgacgccgaagtcgctgctgcgtcac
aagcgtgcagtttcgaccctcaacgaactgtcgggcgaatcctcgttccaccgtctgctg
tgggacgatgcgcagtacaacaaggacgaaggcatcaagctccagaaggatgcaaagatc
cgtcgcgtcgttctctgctcgggcaaggtctattacgacctttacgaagagcgtgaaaag
cgtggcatcgatgacgtctacctgctgcgtgtcgaacagctttatccgtttccggccaag
gcactcatcaatgagctgtcacgcttccgccatgcggaaatggtctggtgtcaggaagag
ccgaagaacatgggcgcatggtcgttcatcgacccgtatctggaatgggtgctggctcat
atcgacgccaagcatcagcgcgtgcgctatgcaggccgtccggcggcagcatcgcctgca
acgggtctgatgtcgaagcatcttgcgcagctcgccgctttccttgaggatgcgctcggt
aactga

DBGET integrated database retrieval system