KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1940Help
Entry
Oant_1940         CDS       T00568                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
KEGG Orthology (KO) [BR:oan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:oan03012]
    Oant_1940
   03029 Mitochondrial biogenesis [BR:oan03029]
    Oant_1940
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oan04147]
    Oant_1940
Translation factors [BR:oan03012]
 Eukaryotic Type
  Elongation factors
   Oant_1940
 Prokaryotic Type
   Oant_1940
Mitochondrial biogenesis [BR:oan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Oant_1940
Exosome [BR:oan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Oant_1940
  Exosomal proteins of breast cancer cells
   Oant_1940
  Exosomal proteins of colorectal cancer cells
   Oant_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABS14656
UniProt: A6X0A2
LinkDB All DBs
Position
1:2040867..2042042
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYDFPGDEVPIIKGSALAALEDSSKE
LGEDAVRSLMAAVDDYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATAKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgaacgtacgaagccccacgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgactgcagcgatcacgaagtttttcggcgagttcaag
gcgtatgaccagatcgacgccgctcctgaagagcgcgcccgcggcatcacgatctcgacg
gcacacgtcgagtacgaaacgccgaaccgtcactatgcacacgtcgactgcccaggtcac
gctgactatgtgaagaacatgatcaccggtgctgcccagatggacggcgcaattctggtt
gtttcggccgctgacggcccgatgccgcagacccgtgagcacatcctgctcgctcgtcag
gttggcgttccggcaatcgtcgtgttcctgaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagttcgcgaacttctgtcgaaatacgatttcccgggc
gacgaagttccgatcatcaagggctcggctcttgctgctctggaagattcttcgaaggaa
ctgggcgaagacgccgttcgttcgctgatggccgctgttgacgactacattccgaccccg
gaacgtccgatcgaccagccgttcctgatgccgatcgaagacgttttctcgatctcgggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgtcaaggttggtgaagaagtt
gaaatcgtcggcatcaaggcgacggcgaagacgacggtaaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacatcggcgctctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagttcaaggcagaagcctacattctgaccaaggacgaaggtggccgtcatacgccgttc
tttacgaactaccgtccgcagttctacttccgcacgacggacgtgaccggtgttgtcacg
ctgccggaaggcacggaaatggttatgcctggcgacaacgtcgctatggacgtcaccctg
atcgtgccgatcgccatggaagagaagctccgcttcgctatccgtgaaggcggccgcacc
gtcggtgctggcatcgtctcctcgatcatcgagtaa

DBGET integrated database retrieval system